diff --git a/.github/workflows/deploy.yml b/.github/workflows/deploy.yml new file mode 100644 index 0000000..77fa9fe --- /dev/null +++ b/.github/workflows/deploy.yml @@ -0,0 +1,48 @@ +name: Build and Deploy + +on: + push: + branches: + - main + pull_request: + branches: + - '*' + +jobs: + build: + runs-on: ubuntu-latest + steps: + - name: Checkout + uses: actions/checkout@v3 + - name: Setup Python + uses: actions/setup-python@v4 + with: + python-version: '3.10' + - name: Install the dependencies + run: | + python -m pip install -r requirements.txt + - name: Build the JupyterLite site + run: | + cp README.md content + jupyter lite build --contents content --output-dir dist + - name: Upload artifact + uses: actions/upload-pages-artifact@v1 + with: + path: ./dist + + deploy: + needs: build + if: github.ref == 'refs/heads/main' + permissions: + pages: write + id-token: write + + environment: + name: github-pages + url: ${{ steps.deployment.outputs.page_url }} + + runs-on: ubuntu-latest + steps: + - name: Deploy to GitHub Pages + id: deployment + uses: actions/deploy-pages@v1 diff --git a/.gitignore b/.gitignore new file mode 100644 index 0000000..b661992 --- /dev/null +++ b/.gitignore @@ -0,0 +1,116 @@ +*.bundle.* +lib/ +node_modules/ +.yarn-packages/ +*.egg-info/ +.ipynb_checkpoints +*.tsbuildinfo + +# Created by https://www.gitignore.io/api/python +# Edit at https://www.gitignore.io/?templates=python + +### Python ### +# Byte-compiled / optimized / DLL files +__pycache__/ +*.py[cod] +*$py.class + +# C extensions +*.so + +# Distribution / packaging +.Python +build/ +develop-eggs/ +dist/ +downloads/ +eggs/ +.eggs/ +lib/ +lib64/ +parts/ +sdist/ +var/ +wheels/ +pip-wheel-metadata/ +share/python-wheels/ +.installed.cfg +*.egg +MANIFEST + +# PyInstaller +# Usually these files are written by a python script from a template +# before PyInstaller builds the exe, so as to inject date/other infos into it. +*.manifest +*.spec + +# Installer logs +pip-log.txt +pip-delete-this-directory.txt + +# Unit test / coverage reports +htmlcov/ +.tox/ +.nox/ +.coverage +.coverage.* +.cache +nosetests.xml +coverage.xml +*.cover +.hypothesis/ +.pytest_cache/ + +# Translations +*.mo +*.pot + +# Scrapy stuff: +.scrapy + +# Sphinx documentation +docs/_build/ + +# PyBuilder +target/ + +# pyenv +.python-version + +# celery beat schedule file +celerybeat-schedule + +# SageMath parsed files +*.sage.py + +# Spyder project settings +.spyderproject +.spyproject + +# Rope project settings +.ropeproject + +# Mr Developer +.mr.developer.cfg +.project +.pydevproject + +# mkdocs documentation +/site + +# mypy +.mypy_cache/ +.dmypy.json +dmypy.json + +# Pyre type checker +.pyre/ + +# OS X stuff +*.DS_Store + +# End of https://www.gitignore.io/api/python + +# jupyterlite +*.doit.db +_output diff --git a/.nojekyll b/.nojekyll new file mode 100644 index 0000000..8b13789 --- /dev/null +++ b/.nojekyll @@ -0,0 +1 @@ + diff --git a/README.md b/README.md new file mode 100644 index 0000000..f8d0424 --- /dev/null +++ b/README.md @@ -0,0 +1,29 @@ +# JupyterLite Demo + +[![lite-badge](https://jupyterlite.rtfd.io/en/latest/_static/badge.svg)](https://jupyterlite.github.io/demo) + +JupyterLite deployed as a static site to GitHub Pages, for demo purposes. + +## ✨ Try it in your browser ✨ + +➡️ **https://jupyterlite.github.io/demo** + +![github-pages](https://user-images.githubusercontent.com/591645/120649478-18258400-c47d-11eb-80e5-185e52ff2702.gif) + +## Requirements + +JupyterLite is being tested against modern web browsers: + +- Firefox 90+ +- Chromium 89+ + +## Deploy your JupyterLite website on GitHub Pages + +Check out the guide on the JupyterLite documentation: https://jupyterlite.readthedocs.io/en/latest/quickstart/deploy.html + +## Further Information and Updates + +For more info, keep an eye on the JupyterLite documentation: + +- How-to Guides: https://jupyterlite.readthedocs.io/en/latest/howto/index.html +- Reference: https://jupyterlite.readthedocs.io/en/latest/reference/index.html diff --git a/content/data/Museums_in_DC.geojson b/content/data/Museums_in_DC.geojson new file mode 100644 index 0000000..a20a9e6 --- /dev/null +++ b/content/data/Museums_in_DC.geojson @@ -0,0 +1 @@ +{"type":"FeatureCollection","features":[{"type":"Feature","properties":{"OBJECTID":1,"ADDRESS":"716 MONROE STREET NE","NAME":"AMERICAN POETRY MUSEUM","ADDRESS_ID":309744,"LEGALNAME":"HERITAGE US","ALTNAME":"AMERICAN POETRY MUSEUM","WEBURL":" http://americanpoetrymuseum.org/"},"geometry":{"type":"Point","coordinates":[-76.995003703568,38.9328428790235]}},{"type":"Feature","properties":{"OBJECTID":2,"ADDRESS":"719 6TH STREET NW","NAME":"GERMAN-AMERICAN HERITAGE MUSEUM","ADDRESS_ID":238949,"LEGALNAME":"CORCORAN GALLERY OF ART","ALTNAME":" ","WEBURL":"http://gahmusa.org/"},"geometry":{"type":"Point","coordinates":[-77.01958878310639,38.89911061096782]}},{"type":"Feature","properties":{"OBJECTID":3,"ADDRESS":"1307 NEW HAMPSHIRE AVENUE NW","NAME":"HEURICH HOUSE FOUNDATION","ADDRESS_ID":241060,"LEGALNAME":"U.S. DEPARTMENT OF THE INTERIOR MUSEUM","ALTNAME":"HEURICH HOUSE FOUNDATION","WEBURL":"HTTP://HEURICHHOUSE.ORG"},"geometry":{"type":"Point","coordinates":[-77.04460619923155,38.908030206509885]}},{"type":"Feature","properties":{"OBJECTID":4,"ADDRESS":"950 INDEPENDENCE AVENUE SW","NAME":"NATIONAL MUSEUM OF AFRICAN ART","ADDRESS_ID":293262,"LEGALNAME":"BUILDING PRESERVATION FOUNDATION","ALTNAME":"NATIONAL MUSEUM OF AFRICAN ART","WEBURL":"HTTP://AFRICA.SI.EDU/"},"geometry":{"type":"Point","coordinates":[-77.02550917725944,38.88796214949963]}},{"type":"Feature","properties":{"OBJECTID":5,"ADDRESS":"740 JACKSON PLACE NW","NAME":"THE WHITE HOUSE ENDOWMENT TRUST","ADDRESS_ID":218748,"LEGALNAME":"NATIONAL BUILDING MUSEUM","ALTNAME":"THE WHITE HOUSE ENDOWMENT TRUST","WEBURL":"HTTP://WWW.WHITEHOUSEHISTORY.ORG"},"geometry":{"type":"Point","coordinates":[-77.03820629325264,38.899842529027275]}},{"type":"Feature","properties":{"OBJECTID":6,"ADDRESS":"921 PENNSYLVANIA AVENUE SE","NAME":"OLD NAVAL HOSPITAL FOUNDATION","ADDRESS_ID":82564,"LEGALNAME":"JEWISH WAR VETERANS NATIONAL MEMORIAL MUSEUM ARCHIVES AND LI","ALTNAME":"OLD NAVAL HOSPITAL FOUNDATION","WEBURL":"http://hillcenterdc.org/home/"},"geometry":{"type":"Point","coordinates":[-76.99314290714912,38.8829885933721]}},{"type":"Feature","properties":{"OBJECTID":7,"ADDRESS":"2201 C STREET NW","NAME":"DIPLOMATIC ROOMS FOUNDATION","ADDRESS_ID":243360,"LEGALNAME":"NATIONAL PLASTICS MUSEUM INC","ALTNAME":"DIPLOMATIC ROOMS FOUNDATION","WEBURL":"https://diplomaticrooms.state.gov/home.aspx"},"geometry":{"type":"Point","coordinates":[-77.04831079505838,38.894135140073566]}},{"type":"Feature","properties":{"OBJECTID":8,"ADDRESS":"4400 MASSACHUSETTS AVENUE NW","NAME":"AMERICAN UNIVERSITY MUSEUM AT THE KATZEN ARTS CENTER","ADDRESS_ID":223994,"LEGALNAME":"VERNISSAGE FOUNDATION","ALTNAME":"AMERICAN UNIVERSITY MUSEUM AT THE KATZEN ARTS CENTER","WEBURL":"HTTP://WWW.AMERICAN.EDU/CAS/MUSEUM/"},"geometry":{"type":"Point","coordinates":[-77.08841712551974,38.9390892139132]}},{"type":"Feature","properties":{"OBJECTID":9,"ADDRESS":"2320 S STREET NW","NAME":"TEXTILE MUSEUM","ADDRESS_ID":243164,"LEGALNAME":"SMITHSONIAN INSTITUTION, S. DILLON RIPLEY CENTER","ALTNAME":"TEXTILE MUSEUM","WEBURL":"HTTP://WWW.TEXTILEMUSEUM.ORG"},"geometry":{"type":"Point","coordinates":[-77.0464284034822,38.89880233850966]}},{"type":"Feature","properties":{"OBJECTID":10,"ADDRESS":"1145 17TH STREET NW","NAME":"NATIONAL GEOGRAPHIC MUSEUM","ADDRESS_ID":290192,"LEGALNAME":"CAPITOL HILL RESTORATION SOCIETY INC","ALTNAME":" ","WEBURL":"HTTP://WWW.NATIONALGEOGRAPHIC.COM"},"geometry":{"type":"Point","coordinates":[-77.03815544194862,38.90519711304962]}},{"type":"Feature","properties":{"OBJECTID":11,"ADDRESS":"3501 NEW YORK AVENUE NE","NAME":"THE NATIONAL BONSAI & PENJING MUSEUM","ADDRESS_ID":293238,"LEGALNAME":"NATIONAL BONSAI FOUNDATION","ALTNAME":" ","WEBURL":"https://www.bonsai-nbf.org/contact-us/"},"geometry":{"type":"Point","coordinates":[-76.96989266812075,38.91241055669072]}},{"type":"Feature","properties":{"OBJECTID":12,"ADDRESS":"2020 O STREET NW","NAME":"O STREET MUSEUM","ADDRESS_ID":243057,"LEGALNAME":"LEPIDOPTERISTS SOCIETY","ALTNAME":" ","WEBURL":"http://www.omuseum.org/museum/"},"geometry":{"type":"Point","coordinates":[-77.04592748104784,38.90839101941751]}},{"type":"Feature","properties":{"OBJECTID":13,"ADDRESS":"2101 CONSTITUTION AVENUE NW","NAME":"NATIONAL ACADEMY OF SCIENCES","ADDRESS_ID":242716,"LEGALNAME":"SMITHSONIAN INSTITUTION, NATURAL HISTORY MUSEUM","ALTNAME":"NATIONAL ACADEMY OF SCIENCES","WEBURL":"WWW.NATIONALACADEMIES.ORG/NAS/ARTS"},"geometry":{"type":"Point","coordinates":[-77.0476448925699,38.89296693766957]}},{"type":"Feature","properties":{"OBJECTID":14,"ADDRESS":"2401 FOXHALL ROAD NW","NAME":"KREEGER MUSEUM","ADDRESS_ID":271251,"LEGALNAME":"CONGRESSIONAL CEMETERY","ALTNAME":"KREEGER MUSEUM","WEBURL":"HTTP://WWW.KREEGERMUSEUM.ORG/"},"geometry":{"type":"Point","coordinates":[-77.08878098790044,38.92191197499568]}},{"type":"Feature","properties":{"OBJECTID":15,"ADDRESS":"1250 NEW YORK AVENUE NW","NAME":"THE NATIONAL MUSEUM OF WOMEN IN THE ART","ADDRESS_ID":279010,"LEGALNAME":"NATIONAL MUSEUM OF HEALTH AND MEDICINE","ALTNAME":"THE NATIONAL MUSEUM OF WOMEN IN THE ART","WEBURL":"HTTP://WWW.NMWA.ORG"},"geometry":{"type":"Point","coordinates":[-77.029163689541,38.90005647268176]}},{"type":"Feature","properties":{"OBJECTID":16,"ADDRESS":"900 JEFFERSON DRIVE SW","NAME":"ARTS AND INDUSTRIES BUILDING","ADDRESS_ID":293260,"LEGALNAME":"ANACOSTIA COMMUNITY MUSEUM","ALTNAME":" ","WEBURL":"http://www.si.edu/Museums/arts-and-industries-building"},"geometry":{"type":"Point","coordinates":[-77.02446647929001,38.888201004559114]}},{"type":"Feature","properties":{"OBJECTID":17,"ADDRESS":"736 SICARD STREET SE","NAME":"NATIONAL MUSEUM OF UNITED STATES NAVY","ADDRESS_ID":311896,"LEGALNAME":"BLACK SPORTS LEGENDS FOUNDATION","ALTNAME":"NATIONAL MUSEUM OF UNITED STATES NAVY","WEBURL":"http://www.history.navy.mil/museums/NationalMuseum/org8-1.htm"},"geometry":{"type":"Point","coordinates":[-76.99526950368147,38.87303084860059]}},{"type":"Feature","properties":{"OBJECTID":18,"ADDRESS":"500 17TH STREET NW","NAME":"CORCORAN GALLERY OF ART","ADDRESS_ID":279802,"LEGALNAME":"SMITHSONIAN INSTITUTION, NATIONAL ZOOLOGICAL PARK","ALTNAME":"CORCORAN GALLERY OF ART","WEBURL":"http://www.corcoran.org/"},"geometry":{"type":"Point","coordinates":[-77.0397427304576,38.895854463821884]}},{"type":"Feature","properties":{"OBJECTID":19,"ADDRESS":"2017 I STREET NW","NAME":"THE ARTS CLUB OF WASHINGTON","ADDRESS_ID":285527,"LEGALNAME":"SMITHSONIAN INSTITUTION, NATIONAL MUSEUM OF AFRICAN AMERICAN HISTORY AND CULTURE","ALTNAME":"THE ARTS CLUB OF WASHINGTON","WEBURL":"HTTP://WWW.ARTSCLUBOFWASHINGTON.ORG"},"geometry":{"type":"Point","coordinates":[-77.04573426864144,38.90157618582308]}},{"type":"Feature","properties":{"OBJECTID":20,"ADDRESS":"701 3RD STREET NW","NAME":"LILLIAN AND ALBERT SMALL JEWISH MUSEUM","ADDRESS_ID":293253,"LEGALNAME":"LILLIAN AND ALBERT SMALL JEWISH MUSEUM","ALTNAME":" ","WEBURL":"http://www.jhsgw.org/"},"geometry":{"type":"Point","coordinates":[-77.01493675564363,38.89857205791096]}},{"type":"Feature","properties":{"OBJECTID":21,"ADDRESS":"320 A STREET NE","NAME":"FREDERICK DOUGLASS MUSEUM","ADDRESS_ID":38979,"LEGALNAME":"COSMOS CLUB HISTORIC PRESERVATION FOUNDATION","ALTNAME":" ","WEBURL":"http://www3.nahc.org/fd/"},"geometry":{"type":"Point","coordinates":[-77.00110470253333,38.891131915241964]}},{"type":"Feature","properties":{"OBJECTID":22,"ADDRESS":"1334 G STREET NW","NAME":"ARMENIAN GENOCIDE MUSEUM AND MEMORIAL","ADDRESS_ID":240658,"LEGALNAME":"GERMAN-AMERICAN HERITAGE MUSEUM","ALTNAME":"ARMENIAN GENOCIDE MUSEUM AND MEMORIAL","WEBURL":"http://www.armeniangenocidemuseum.org/"},"geometry":{"type":"Point","coordinates":[-77.03108432435003,38.89804891426683]}},{"type":"Feature","properties":{"OBJECTID":23,"ADDRESS":"1799 NEW YORK AVENUE NW","NAME":"OCTAGON MUSEUM","ADDRESS_ID":218490,"LEGALNAME":"AMERICAN RED CROSS MUSEUM","ALTNAME":" ","WEBURL":"HTTP://WWW.THEOCTAGON.ORG"},"geometry":{"type":"Point","coordinates":[-77.04141820048949,38.89635375607101]}},{"type":"Feature","properties":{"OBJECTID":24,"ADDRESS":"1901 FORT PLACE SE","NAME":"ANACOSTIA COMMUNITY MUSEUM","ADDRESS_ID":286524,"LEGALNAME":"FAUNA & FLORA INTERNATIONAL INC","ALTNAME":"ANACOSTIA COMMUNITY MUSEUM","WEBURL":"HTTP://ANACOSTIA.SI.EDU"},"geometry":{"type":"Point","coordinates":[-76.97678467186984,38.8565826636904]}},{"type":"Feature","properties":{"OBJECTID":25,"ADDRESS":"2312 CALIFORNIA STREET NW","NAME":"NATIONAL MUSEUM OF THE JEWISH PEOPLE","ADDRESS_ID":234961,"LEGALNAME":"GREENSEED COMMUNITY GARDEN LAND TRUST","ALTNAME":" ","WEBURL":"http://www.nsideas.com/archive/nmjh/"},"geometry":{"type":"Point","coordinates":[-77.05118108814123,38.91537084189858]}},{"type":"Feature","properties":{"OBJECTID":26,"ADDRESS":"430 17TH STREET NW","NAME":"AMERICAN RED CROSS MUSEUM","ADDRESS_ID":300987,"LEGALNAME":"DOUBLE M MANAGEMENT","ALTNAME":"AMERICAN RED CROSS MUSEUM","WEBURL":"http://www.redcross.org/"},"geometry":{"type":"Point","coordinates":[-77.04020705622152,38.89482654014118]}},{"type":"Feature","properties":{"OBJECTID":27,"ADDRESS":"1600 21ST STREET NW","NAME":"THE PHILLIPS COLLECTION","ADDRESS_ID":243333,"LEGALNAME":"SMITHSONIAN INSTITUTION, RENWICK GALLERY","ALTNAME":"THE PHILLIPS COLLECTION","WEBURL":"HTTP://WWW.PHILLIPSCOLLECTION.ORG"},"geometry":{"type":"Point","coordinates":[-77.04685454590388,38.91150979086159]}},{"type":"Feature","properties":{"OBJECTID":28,"ADDRESS":"800 F STREET NW","NAME":"INTERNATIONAL SPY MUSEUM","ADDRESS_ID":238378,"LEGALNAME":"CONFEDERATE MEMORIAL HALL ASSOCIATION","ALTNAME":"INTERNATIONAL SPY MUSEUM","WEBURL":"HTTP://WWW.SPYMUSEUM.ORG/"},"geometry":{"type":"Point","coordinates":[-77.02328618491306,38.896986480912865]}},{"type":"Feature","properties":{"OBJECTID":29,"ADDRESS":"100 RAOUL WALLENBERG PLACE SW","NAME":"UNITED STATES HOLOCAUST MEMORIAL MUSEUM","ADDRESS_ID":293186,"LEGALNAME":"NATIONAL MUSIC CENTER AND MUSEUM FOUNDATION","ALTNAME":"UNITED STATES HOLOCAUST MEMORIAL MUSEUM","WEBURL":"HTTP://WWW.USHMM.ORG"},"geometry":{"type":"Point","coordinates":[-77.03268853739414,38.88668873773371]}},{"type":"Feature","properties":{"OBJECTID":30,"ADDRESS":"801 K STREET NW","NAME":"HISTORICAL SOCIETY OF WASHINGTON DC","ADDRESS_ID":238956,"LEGALNAME":"Historical Society of Washington, D.C","ALTNAME":" ","WEBURL":"http://www.dchistory.org/"},"geometry":{"type":"Point","coordinates":[-77.02294505078932,38.90262956584554]}},{"type":"Feature","properties":{"OBJECTID":31,"ADDRESS":"1849 C STREET NW","NAME":"INTERIOR MUSEUM","ADDRESS_ID":293214,"LEGALNAME":"VICE PRESIDENTS RESIDENCE FOUNDATION","ALTNAME":"INTERIOR MUSEUM","WEBURL":"HTTP://WWW.DOI.GOV/INTERIORMUSEUM"},"geometry":{"type":"Point","coordinates":[-77.04260256434321,38.89445283458921]}},{"type":"Feature","properties":{"OBJECTID":32,"ADDRESS":"4155 LINNEAN AVENUE NW","NAME":"HILLWOOD MUSEUM & GARDENS","ADDRESS_ID":284839,"LEGALNAME":"SMITHSONIAN INSTITUTION, NATIONAL GALLERY OF ART","ALTNAME":"HILLWOOD MUSEUM & GARDENS","WEBURL":"WWW.HILLWOODMUSEUM.ORG"},"geometry":{"type":"Point","coordinates":[-77.0526196505072,38.94364171194315]}},{"type":"Feature","properties":{"OBJECTID":33,"ADDRESS":"1318 VERMONT AVENUE NW","NAME":"BETHUNE MEMORIAL MUSEUM","ADDRESS_ID":225385,"LEGALNAME":"NATIONAL MUSEUM OF WOMEN IN THE ARTS INC","ALTNAME":" ","WEBURL":"http://www.nps.gov/mamc/index.htm"},"geometry":{"type":"Point","coordinates":[-77.03086564182146,38.90817580546652]}},{"type":"Feature","properties":{"OBJECTID":34,"ADDRESS":"1500 MASSACHUSETTS AVENUE NW","NAME":"NATIONAL MUSEUM OF CATHOLIC ART AND LIBRARY","ADDRESS_ID":242324,"LEGALNAME":"KREEGER MUSEUM","ALTNAME":" ","WEBURL":"http://nmcal.org/nmcah_exhibition_in_washington.html"},"geometry":{"type":"Point","coordinates":[-77.03551120800971,38.90651019329394]}},{"type":"Feature","properties":{"OBJECTID":35,"ADDRESS":"1 MASSACHUSETTS AVENUE NW","NAME":"NATIONAL GUARD MEMORIAL MUSEUM","ADDRESS_ID":238009,"LEGALNAME":"CARL SCHMITT FOUNDATION INC","ALTNAME":" ","WEBURL":"HTTP://WWW.NGEF.ORG"},"geometry":{"type":"Point","coordinates":[-77.00956143652462,38.89812580681995]}},{"type":"Feature","properties":{"OBJECTID":36,"ADDRESS":"1811 R STREET NW","NAME":"NATIONAL MUSEUM OF AMERICAN JEWISH MILITARY HISTORY","ADDRESS_ID":243292,"LEGALNAME":"CITY TAVERN PRESERVATION FOUNDATION","ALTNAME":"JEWISH WAR VETERANS NATIONAL MEMORIAL MUSEUM ARCHIVES AND LIBRARY","WEBURL":"http://www.nmajmh.org/"},"geometry":{"type":"Point","coordinates":[-77.04211577477285,38.91282059721026]}},{"type":"Feature","properties":{"OBJECTID":37,"ADDRESS":"3900 HAREWOOD ROAD NE","NAME":"POPE JOHN PAUL II CULTURAL CENTER","ADDRESS_ID":288031,"LEGALNAME":"AMERICAN POETRY MUSEUM","ALTNAME":" ","WEBURL":"HTTP://WWW.JP2CC.ORG"},"geometry":{"type":"Point","coordinates":[-77.00466710351098,38.93776654366721]}},{"type":"Feature","properties":{"OBJECTID":38,"ADDRESS":"700 PENNSYLVANIA AVENUE NW","NAME":"NATIONAL ARCHIVES MUSEUM","ADDRESS_ID":293251,"LEGALNAME":"PHILLIPS COLLECTION","ALTNAME":"NATIONAL ARCHIVES MUSEUM","WEBURL":"https://www.archives.gov/dc-metro/washington/"},"geometry":{"type":"Point","coordinates":[-77.0228592459719,38.89285370583677]}},{"type":"Feature","properties":{"OBJECTID":39,"ADDRESS":"201 18TH STREET NW","NAME":"ART MUSEUM OF THE AMERICAS","ADDRESS_ID":294191,"LEGALNAME":"Art Museum of the Americas","ALTNAME":" ","WEBURL":"http://www.museum.oas.org/"},"geometry":{"type":"Point","coordinates":[-77.04147388756545,38.892799844291474]}},{"type":"Feature","properties":{"OBJECTID":40,"ADDRESS":"9 HILLYER COURT NW","NAME":"INTERNATIONAL ARTS & ARTISTS","ADDRESS_ID":279975,"LEGALNAME":"THE INTERNATIONAL SPY MUSEUM","ALTNAME":"INTERNATIONAL ARTS & ARTISTS","WEBURL":"WWW.ARTSANDARTISTS.ORG"},"geometry":{"type":"Point","coordinates":[-77.04730884101534,38.91222144699389]}},{"type":"Feature","properties":{"OBJECTID":41,"ADDRESS":"2 MASSACHUSETTS AVENUE NE","NAME":"NATIONAL POSTAL MUSEUM","ADDRESS_ID":293217,"LEGALNAME":"BEAD SOCIETY OF GREATER WASHINGTON","ALTNAME":"NATIONAL POSTAL MUSEUM","WEBURL":"HTTP://POSTALMUSEUM.SI.EDU"},"geometry":{"type":"Point","coordinates":[-77.00819124512859,38.8981463599396]}},{"type":"Feature","properties":{"OBJECTID":42,"ADDRESS":"1519 MONROE STREET NW","NAME":"POWHATAN MUSEUM","ADDRESS_ID":234557,"LEGALNAME":"AMERICAN UNIVERSITY MUSEUM","ALTNAME":" ","WEBURL":"http://www.powhatanmuseum.com/"},"geometry":{"type":"Point","coordinates":[-77.03550660261739,38.93243814726252]}},{"type":"Feature","properties":{"OBJECTID":43,"ADDRESS":"144 CONSTITUTION AVENUE NE","NAME":"SEWALL-BELMONT HOUSE AND MUSEUM","ADDRESS_ID":286201,"LEGALNAME":"AMERICAN MUSEUM OF PEACE INC","ALTNAME":" ","WEBURL":"HTTP://WWW.SEWALLBELMONT.ORG"},"geometry":{"type":"Point","coordinates":[-77.00375845550963,38.89219466787653]}},{"type":"Feature","properties":{"OBJECTID":44,"ADDRESS":"802 MASSACHUSETTS AVENUE NE","NAME":"SHOOK MUSEUM FOUNDATION","ADDRESS_ID":79669,"LEGALNAME":"GREENPEACE FUND","ALTNAME":" ","WEBURL":"SHOOKMUSEUM.ORG"},"geometry":{"type":"Point","coordinates":[-76.9944246526475,38.891834530779185]}},{"type":"Feature","properties":{"OBJECTID":45,"ADDRESS":"1400 CONSTITUTION AVENUE NW","NAME":"SMITHSONIAN INSTITUTION, NATIONAL MUSEUM OF NATURAL HISTORY","ADDRESS_ID":310702,"LEGALNAME":"B'NAI B'RITH KLUTZNICK MUSEUM","ALTNAME":"SMITHSONIAN INSTITUTION, NATIONAL MUSEUM OF NATURAL HISTORY","WEBURL":"http://www.mnh.si.edu/"},"geometry":{"type":"Point","coordinates":[-77.02591603234607,38.89121850995097]}},{"type":"Feature","properties":{"OBJECTID":46,"ADDRESS":"500 HOWARD PLACE NW","NAME":"HOWARD UNIVERSITY MUSEUM","ADDRESS_ID":243398,"LEGALNAME":"COLLECTONS STRIES AMRCN MSLIMS","ALTNAME":" ","WEBURL":"http://www.coas.howard.edu/msrc/museum.html"},"geometry":{"type":"Point","coordinates":[-77.0196991986925,38.922360224748935]}},{"type":"Feature","properties":{"OBJECTID":47,"ADDRESS":"8TH STREET NW AND F ST NW","NAME":"NATIONAL PORTRAIT GALLERY","ADDRESS_ID":294248,"LEGALNAME":"BOHEMIA ARTS","ALTNAME":"NATIONAL PORTRAIT GALLERY","WEBURL":"HTTP://WWW.NPG.SI.EDU"},"geometry":{"type":"Point","coordinates":[-77.02295571583119,38.89815890118559]}},{"type":"Feature","properties":{"OBJECTID":48,"ADDRESS":"14TH STREET NW AND CONSTITUTION AVENUE NW","NAME":"NATIONAL MUSEUM OF AFRICAN AMERICAN HISTORY AND CULTURE","ADDRESS_ID":903110,"LEGALNAME":"AMERICANS FOR BATTLEFIELD PRESERVATION","ALTNAME":"NATIONAL MUSEUM OF AFRICAN AMERICAN HISTORY AND CULTURE","WEBURL":"HTTP://WWW.NMAAHC.SI.EDU/"},"geometry":{"type":"Point","coordinates":[-77.03271597832732,38.89119983415094]}},{"type":"Feature","properties":{"OBJECTID":49,"ADDRESS":"4TH STREET SW AND INDEPENDENCE AVENUE SW","NAME":"NATIONAL MUSEUM OF AMERICAN INDIAN","ADDRESS_ID":294429,"LEGALNAME":"BLAIR HOUSE RESTORATION FUND","ALTNAME":" ","WEBURL":"WWW.NMAI.SI.EDU"},"geometry":{"type":"Point","coordinates":[-77.01672595283219,38.88826561652]}},{"type":"Feature","properties":{"OBJECTID":50,"ADDRESS":"6TH STREET SW AND INDEPENDENCE AVENUE SW","NAME":"NATIONAL AIR AND SPACE MUSEUM","ADDRESS_ID":301565,"LEGALNAME":"BETHUNE MEMORIAL MUSEUM","ALTNAME":"NATIONAL AIR AND SPACE MUSEUM","WEBURL":"HTTP://WWW.NASM.SI.EDU/"},"geometry":{"type":"Point","coordinates":[-77.01979999825605,38.888161175521944]}},{"type":"Feature","properties":{"OBJECTID":51,"ADDRESS":"7THB STREET AND INDEPENDENCE AVENUE SW","NAME":"HIRSHHORN MUSEUM AND SCULPTURE GARDEN","ADDRESS_ID":294428,"LEGALNAME":"D.C. OFFICE OF PUBLIC RECORDS AND ARCHIVES","ALTNAME":"HIRSHHORN MUSEUM AND SCULPTURE GARDEN","WEBURL":"HTTP://HIRSHHORN.SI.EDU/"},"geometry":{"type":"Point","coordinates":[-77.02294902891254,38.88843565656003]}},{"type":"Feature","properties":{"OBJECTID":52,"ADDRESS":"MADISON DRIVE NW AND 12TH STREET NW","NAME":"SMITHSONIAN INSTITUTION, NATIONAL MUSEUM OF AMERICAN HISTORY","ADDRESS_ID":293200,"LEGALNAME":null,"ALTNAME":"SMITHSONIAN INSTITUTION, NATIONAL MUSEUM OF AMERICAN HISTORY","WEBURL":"HTTP://AMERICANHISTORY.SI.EDU"},"geometry":{"type":"Point","coordinates":[-77.03005156534492,38.89123181993075]}},{"type":"Feature","properties":{"OBJECTID":53,"ADDRESS":"4TH STREET NW AND MADISON DRIVE NW","NAME":"NATIONAL GALLERY OF ART - EAST BUILDING","ADDRESS_ID":293209,"LEGALNAME":null,"ALTNAME":null,"WEBURL":"http://www.nga.gov/content/ngaweb/visit/maps-and-information/east-building.html"},"geometry":{"type":"Point","coordinates":[-77.01668919569053,38.89125721273486]}},{"type":"Feature","properties":{"OBJECTID":54,"ADDRESS":"4TH STREET NW AND MADISON DRIVE NW","NAME":"NATIONAL GALLERY OF ART - WEST BUILDING","ADDRESS_ID":293249,"LEGALNAME":null,"ALTNAME":null,"WEBURL":"http://www.nga.gov/content/ngaweb/visit/maps-and-information/west-building.html"},"geometry":{"type":"Point","coordinates":[-77.01989150273015,38.891313914429645]}},{"type":"Feature","properties":{"OBJECTID":55,"ADDRESS":"1000 JEFFERSON DRIVE SW","NAME":"SMITHSONIAN INSTITUTION - CASTLE","ADDRESS_ID":293187,"LEGALNAME":null,"ALTNAME":null,"WEBURL":"http://www.si.edu/Museums/smithsonian-institution-building"},"geometry":{"type":"Point","coordinates":[-77.02597189316775,38.88879577572046]}},{"type":"Feature","properties":{"OBJECTID":56,"ADDRESS":"1050 INDEPENDENCE AVENUE SW","NAME":"SACKLER GALLERY","ADDRESS_ID":293191,"LEGALNAME":"ARTHUR M. SACKLER GALLERY","ALTNAME":null,"WEBURL":"http://www.asia.si.edu/"},"geometry":{"type":"Point","coordinates":[-77.02645343758842,38.88796502751886]}},{"type":"Feature","properties":{"OBJECTID":57,"ADDRESS":"JEFFERSON DRIVE SW AND 12TH STREET SW","NAME":"FREER GALLERY","ADDRESS_ID":294417,"LEGALNAME":"FREER GALLERY OF ART","ALTNAME":null,"WEBURL":"http://www.asia.si.edu/"},"geometry":{"type":"Point","coordinates":[-77.02736845485786,38.8882746680144]}}]} \ No newline at end of file diff --git a/content/data/bar.vl.json b/content/data/bar.vl.json new file mode 100644 index 0000000..f5b7b37 --- /dev/null +++ b/content/data/bar.vl.json @@ -0,0 +1,54 @@ +{ + "data": { + "values": [ + { + "a": "A", + "b": 28 + }, + { + "a": "B", + "b": 55 + }, + { + "a": "C", + "b": 43 + }, + { + "a": "D", + "b": 91 + }, + { + "a": "E", + "b": 81 + }, + { + "a": "F", + "b": 53 + }, + { + "a": "G", + "b": 19 + }, + { + "a": "H", + "b": 87 + }, + { + "a": "I", + "b": 52 + } + ] + }, + "description": "A simple bar chart with embedded data.", + "encoding": { + "x": { + "field": "a", + "type": "ordinal" + }, + "y": { + "field": "b", + "type": "quantitative" + } + }, + "mark": "bar" +} diff --git a/content/data/fasta-example.fasta b/content/data/fasta-example.fasta new file mode 100644 index 0000000..cfcbad5 --- /dev/null +++ b/content/data/fasta-example.fasta @@ -0,0 +1,8 @@ +>SEQUENCE_1 +MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG +LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK +IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL +MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL +>SEQUENCE_2 +SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI +ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH \ No newline at end of file diff --git a/content/data/iris.csv b/content/data/iris.csv new file mode 100644 index 0000000..43ff582 --- /dev/null +++ b/content/data/iris.csv @@ -0,0 +1,151 @@ +sepal_length,sepal_width,petal_length,petal_width,species +5.1,3.5,1.4,0.2,se +4.9,3,1.4,0.2,setosa +4.7,3.2,1.3,0.2,setosa +4.6,3.1,1.5,0.2,setosa +5,3.6,1.4,0.2,setosa +5.4,3.9,1.7,0.4,setosa +4.6,3.4,1.4,0.3,setosa +5,3.4,1.5,0.2,setosa +4.4,2.9,1.4,0.2,setosa +4.9,3.1,1.5,0.1,setosa +5.4,3.7,1.5,0.2,setosa +4.8,3.4,1.6,0.2,setosa +4.8,3,1.4,0.1,setosa +4.3,3,1.1,0.1,setosa +5.8,4,1.2,0.2,setosa +5.7,4.4,1.5,0.4,setosa +5.4,3.9,1.3,0.4,setosa +5.1,3.5,1.4,0.3,setosa +5.7,3.8,1.7,0.3,setosa +5.1,3.8,1.5,0.3,setosa +5.4,3.4,1.7,0.2,setosa +5.1,3.7,1.5,0.4,setosa +4.6,3.6,1,0.2,setosa +5.1,3.3,1.7,0.5,setosa +4.8,3.4,1.9,0.2,setosa +5,3,1.6,0.2,setosa +5,3.4,1.6,0.4,setosa +5.2,3.5,1.5,0.2,setosa +5.2,3.4,1.4,0.2,setosa +4.7,3.2,1.6,0.2,setosa +4.8,3.1,1.6,0.2,setosa +5.4,3.4,1.5,0.4,setosa +5.2,4.1,1.5,0.1,setosa +5.5,4.2,1.4,0.2,setosa +4.9,3.1,1.5,0.1,setosa +5,3.2,1.2,0.2,setosa +5.5,3.5,1.3,0.2,setosa +4.9,3.1,1.5,0.1,setosa +4.4,3,1.3,0.2,setosa +5.1,3.4,1.5,0.2,setosa +5,3.5,1.3,0.3,setosa +4.5,2.3,1.3,0.3,setosa +4.4,3.2,1.3,0.2,setosa +5,3.5,1.6,0.6,setosa +5.1,3.8,1.9,0.4,setosa +4.8,3,1.4,0.3,setosa +5.1,3.8,1.6,0.2,setosa +4.6,3.2,1.4,0.2,setosa +5.3,3.7,1.5,0.2,setosa +5,3.3,1.4,0.2,setosa +7,3.2,4.7,1.4,versicolor +6.4,3.2,4.5,1.5,versicolor +6.9,3.1,4.9,1.5,versicolor +5.5,2.3,4,1.3,versicolor +6.5,2.8,4.6,1.5,versicolor +5.7,2.8,4.5,1.3,versicolor +6.3,3.3,4.7,1.6,versicolor +4.9,2.4,3.3,1,versicolor +6.6,2.9,4.6,1.3,versicolor +5.2,2.7,3.9,1.4,versicolor +5,2,3.5,1,versicolor +5.9,3,4.2,1.5,versicolor +6,2.2,4,1,versicolor +6.1,2.9,4.7,1.4,versicolor +5.6,2.9,3.6,1.3,versicolor +6.7,3.1,4.4,1.4,versicolor +5.6,3,4.5,1.5,versicolor +5.8,2.7,4.1,1,versicolor +6.2,2.2,4.5,1.5,versicolor +5.6,2.5,3.9,1.1,versicolor +5.9,3.2,4.8,1.8,versicolor +6.1,2.8,4,1.3,versicolor +6.3,2.5,4.9,1.5,versicolor +6.1,2.8,4.7,1.2,versicolor +6.4,2.9,4.3,1.3,versicolor +6.6,3,4.4,1.4,versicolor +6.8,2.8,4.8,1.4,versicolor +6.7,3,5,1.7,versicolor +6,2.9,4.5,1.5,versicolor +5.7,2.6,3.5,1,versicolor +5.5,2.4,3.8,1.1,versicolor +5.5,2.4,3.7,1,versicolor +5.8,2.7,3.9,1.2,versicolor +6,2.7,5.1,1.6,versicolor +5.4,3,4.5,1.5,versicolor +6,3.4,4.5,1.6,versicolor +6.7,3.1,4.7,1.5,versicolor +6.3,2.3,4.4,1.3,versicolor +5.6,3,4.1,1.3,versicolor +5.5,2.5,4,1.3,versicolor +5.5,2.6,4.4,1.2,versicolor +6.1,3,4.6,1.4,versicolor +5.8,2.6,4,1.2,versicolor +5,2.3,3.3,1,versicolor +5.6,2.7,4.2,1.3,versicolor +5.7,3,4.2,1.2,versicolor +5.7,2.9,4.2,1.3,versicolor +6.2,2.9,4.3,1.3,versicolor +5.1,2.5,3,1.1,versicolor +5.7,2.8,4.1,1.3,versicolor +6.3,3.3,6,2.5,virginica +5.8,2.7,5.1,1.9,virginica +7.1,3,5.9,2.1,virginica +6.3,2.9,5.6,1.8,virginica +6.5,3,5.8,2.2,virginica +7.6,3,6.6,2.1,virginica +4.9,2.5,4.5,1.7,virginica +7.3,2.9,6.3,1.8,virginica +6.7,2.5,5.8,1.8,virginica +7.2,3.6,6.1,2.5,virginica +6.5,3.2,5.1,2,virginica +6.4,2.7,5.3,1.9,virginica +6.8,3,5.5,2.1,virginica +5.7,2.5,5,2,virginica +5.8,2.8,5.1,2.4,virginica +6.4,3.2,5.3,2.3,virginica +6.5,3,5.5,1.8,virginica +7.7,3.8,6.7,2.2,virginica +7.7,2.6,6.9,2.3,virginica +6,2.2,5,1.5,virginica +6.9,3.2,5.7,2.3,virginica +5.6,2.8,4.9,2,virginica +7.7,2.8,6.7,2,virginica +6.3,2.7,4.9,1.8,virginica +6.7,3.3,5.7,2.1,virginica +7.2,3.2,6,1.8,virginica +6.2,2.8,4.8,1.8,virginica +6.1,3,4.9,1.8,virginica +6.4,2.8,5.6,2.1,virginica +7.2,3,5.8,1.6,virginica +7.4,2.8,6.1,1.9,virginica +7.9,3.8,6.4,2,virginica +6.4,2.8,5.6,2.2,virginica +6.3,2.8,5.1,1.5,virginica +6.1,2.6,5.6,1.4,virginica +7.7,3,6.1,2.3,virginica +6.3,3.4,5.6,2.4,virginica +6.4,3.1,5.5,1.8,virginica +6,3,4.8,1.8,virginica +6.9,3.1,5.4,2.1,virginica +6.7,3.1,5.6,2.4,virginica +6.9,3.1,5.1,2.3,virginica +5.8,2.7,5.1,1.9,virginica +6.8,3.2,5.9,2.3,virginica +6.7,3.3,5.7,2.5,virginica +6.7,3,5.2,2.3,virginica +6.3,2.5,5,1.9,virginica +6.5,3,5.2,2,virginica +6.2,3.4,5.4,2.3,virginica +5.9,3,5.1,1.8,virginica diff --git a/content/data/matplotlib.png b/content/data/matplotlib.png new file mode 100644 index 0000000..a7fcb1d Binary files /dev/null and b/content/data/matplotlib.png differ diff --git a/content/javascript.ipynb b/content/javascript.ipynb new file mode 100644 index 0000000..a5e7487 --- /dev/null +++ b/content/javascript.ipynb @@ -0,0 +1,86 @@ +{ + "metadata": { + "language_info": { + "codemirror_mode": { + "name": "javascript" + }, + "file_extension": ".js", + "mimetype": "text/javascript", + "name": "javascript", + "nbconvert_exporter": "javascript", + "pygments_lexer": "javascript", + "version": "es2017" + }, + "kernelspec": { + "name": "javascript", + "display_name": "JavaScript", + "language": "javascript" + }, + "toc-showcode": true + }, + "nbformat_minor": 4, + "nbformat": 4, + "cells": [ + { + "cell_type": "markdown", + "source": "# JavaScript in `JupyterLite`\n\n![](https://jupyterlite.readthedocs.io/en/latest/_static/kernelspecs/javascript.svg)", + "metadata": {} + }, + { + "cell_type": "markdown", + "source": "## Standard streams", + "metadata": {} + }, + { + "cell_type": "code", + "source": "console.log('hello world')", + "metadata": { + "trusted": true + }, + "execution_count": null, + "outputs": [] + }, + { + "cell_type": "code", + "source": "console.error('error')", + "metadata": { + "trusted": true + }, + "execution_count": null, + "outputs": [] + }, + { + "cell_type": "markdown", + "source": "## JavaScript specific constructs", + "metadata": {} + }, + { + "cell_type": "code", + "source": "const delay = 2000;\n\nsetTimeout(() => {\n console.log('done');\n}, delay);", + "metadata": { + "trusted": true + }, + "execution_count": null, + "outputs": [] + }, + { + "cell_type": "code", + "source": "var str = \"hello world\"\nstr.split('').forEach(c => {\n console.log(c)\n})", + "metadata": { + "trusted": true + }, + "execution_count": null, + "outputs": [] + }, + { + "cell_type": "markdown", + "source": "## Markdown cells", + "metadata": {} + }, + { + "cell_type": "markdown", + "source": "Lorenz system of differential equations\n\n$$\n\\begin{aligned}\n\\dot{x} & = \\sigma(y-x) \\\\\n\\dot{y} & = \\rho x - y - xz \\\\\n\\dot{z} & = -\\beta z + xy\n\\end{aligned}\n$$\n", + "metadata": {} + } + ] +} \ No newline at end of file diff --git a/content/p5.ipynb b/content/p5.ipynb new file mode 100644 index 0000000..78be9cb --- /dev/null +++ b/content/p5.ipynb @@ -0,0 +1,150 @@ +{ + "metadata":{ + "kernelspec":{ + "name":"p5js", + "display_name":"p5.js", + "language":"javascript" + }, + "language_info":{ + "codemirror_mode":{ + "name":"javascript" + }, + "file_extension":".js", + "mimetype":"text/javascript", + "name":"p5js", + "nbconvert_exporter":"javascript", + "pygments_lexer":"javascript", + "version":"es2017" + } + }, + "nbformat_minor":4, + "nbformat":4, + "cells":[ + { + "cell_type":"markdown", + "source":"# p5 notebook\n\nA minimal Jupyter notebook UI for [p5.js](https://p5js.org) kernels.", + "metadata":{ + + } + }, + { + "cell_type":"markdown", + "source":"First let's define a couple of variables:", + "metadata":{ + + } + }, + { + "cell_type":"code", + "source":"var n = 4;\nvar speed = 1;", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ] + }, + { + "cell_type":"markdown", + "source":"## The `setup` function\n\nThe usual p5 setup function, which creates the canvas.", + "metadata":{ + + } + }, + { + "cell_type":"code", + "source":"function setup () {\n createCanvas(innerWidth, innerHeight);\n rectMode(CENTER);\n}", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ] + }, + { + "cell_type":"markdown", + "source":"## The `draw` function\n\nFrom the [p5.js documentation](https://p5js.org/reference/#/p5/draw):\n\n> The `draw()` function continuously executes the lines of code contained inside its block until the program is stopped or `noLoop()` is called.", + "metadata":{ + + } + }, + { + "cell_type":"code", + "source":"function draw() {\n background('#ddd');\n translate(innerWidth / 2, innerHeight / 2);\n for (let i = 0; i < n; i++) {\n push();\n rotate(frameCount * speed / 1000 * (i + 1));\n fill(i * 5, i * 100, i * 150);\n const s = 200 - i * 10;\n rect(0, 0, s, s);\n pop();\n }\n}", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ] + }, + { + "cell_type":"markdown", + "source":"## Show the sketch\n\nNow let's show the sketch by using the `%show` magic:", + "metadata":{ + + } + }, + { + "cell_type":"code", + "source":"%show", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ] + }, + { + "cell_type":"markdown", + "source":"## Tweak the values\n\nWe can also tweak some values in real time:", + "metadata":{ + + } + }, + { + "cell_type":"code", + "source":"speed = 3", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ] + }, + { + "cell_type":"code", + "source":"n = 20", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ] + }, + { + "cell_type":"markdown", + "source":"We can also show the sketch a second time taking into account the new values:", + "metadata":{ + + } + }, + { + "cell_type":"code", + "source":"%show", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ] + } + ] +} \ No newline at end of file diff --git a/content/pyodide/altair.ipynb b/content/pyodide/altair.ipynb new file mode 100644 index 0000000..d7b8780 --- /dev/null +++ b/content/pyodide/altair.ipynb @@ -0,0 +1,231 @@ +{ + "cells": [ + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# Altair in `JupyterLite`\n", + "\n", + "**Altair** is a declarative statistical visualization library for Python.\n", + "\n", + "Most of the examples below are from: https://altair-viz.github.io/gallery" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Import the dependencies:" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "%pip install -q altair" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Simple Bar Chart" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import altair as alt\n", + "import pandas as pd\n", + "\n", + "source = pd.DataFrame({\n", + " 'a': ['A', 'B', 'C', 'D', 'E', 'F', 'G', 'H', 'I'],\n", + " 'b': [28, 55, 43, 91, 81, 53, 19, 87, 52]\n", + "})\n", + "\n", + "alt.Chart(source).mark_bar().encode(\n", + " x='a',\n", + " y='b'\n", + ")" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Simple Heatmap" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import altair as alt\n", + "import numpy as np\n", + "import pandas as pd\n", + "\n", + "# Compute x^2 + y^2 across a 2D grid\n", + "x, y = np.meshgrid(range(-5, 5), range(-5, 5))\n", + "z = x ** 2 + y ** 2\n", + "\n", + "# Convert this grid to columnar data expected by Altair\n", + "source = pd.DataFrame({'x': x.ravel(),\n", + " 'y': y.ravel(),\n", + " 'z': z.ravel()})\n", + "\n", + "alt.Chart(source).mark_rect().encode(\n", + " x='x:O',\n", + " y='y:O',\n", + " color='z:Q'\n", + ")\n" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Install the Vega Dataset" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "%pip install -q vega_datasets" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Interactive Average" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import altair as alt\n", + "from vega_datasets import data\n", + "\n", + "source = data.seattle_weather()\n", + "brush = alt.selection(type='interval', encodings=['x'])\n", + "\n", + "bars = alt.Chart().mark_bar().encode(\n", + " x='month(date):O',\n", + " y='mean(precipitation):Q',\n", + " opacity=alt.condition(brush, alt.OpacityValue(1), alt.OpacityValue(0.7)),\n", + ").add_selection(\n", + " brush\n", + ")\n", + "\n", + "line = alt.Chart().mark_rule(color='firebrick').encode(\n", + " y='mean(precipitation):Q',\n", + " size=alt.SizeValue(3)\n", + ").transform_filter(\n", + " brush\n", + ")\n", + "\n", + "alt.layer(bars, line, data=source)" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Locations of US Airports" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import altair as alt\n", + "from vega_datasets import data\n", + "\n", + "airports = data.airports.url\n", + "states = alt.topo_feature(data.us_10m.url, feature='states')\n", + "\n", + "# US states background\n", + "background = alt.Chart(states).mark_geoshape(\n", + " fill='lightgray',\n", + " stroke='white'\n", + ").properties(\n", + " width=500,\n", + " height=300\n", + ").project('albersUsa')\n", + "\n", + "# airport positions on background\n", + "points = alt.Chart(airports).transform_aggregate(\n", + " latitude='mean(latitude)',\n", + " longitude='mean(longitude)',\n", + " count='count()',\n", + " groupby=['state']\n", + ").mark_circle().encode(\n", + " longitude='longitude:Q',\n", + " latitude='latitude:Q',\n", + " size=alt.Size('count:Q', title='Number of Airports'),\n", + " color=alt.value('steelblue'),\n", + " tooltip=['state:N','count:Q']\n", + ").properties(\n", + " title='Number of airports in US'\n", + ")\n", + "\n", + "background + points\n" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python (Pyodide)", + "language": "python", + "name": "python" + }, + "language_info": { + "codemirror_mode": { + "name": "python", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.8" + } + }, + "nbformat": 4, + "nbformat_minor": 4 +} diff --git a/content/pyodide/folium.ipynb b/content/pyodide/folium.ipynb new file mode 100644 index 0000000..2828de0 --- /dev/null +++ b/content/pyodide/folium.ipynb @@ -0,0 +1,154 @@ +{ + "cells": [ + { + "cell_type": "markdown", + "metadata": { + "tags": [] + }, + "source": [ + "# `folium` Interactive Map Demo\n", + "\n", + "Simple demonstration of rendering a map in a `jupyterlite` notebook.\n", + "\n", + "Note that the `folium` package has several dependencies which themselves may have dependencies.\n", + "\n", + "The following code fragement, run in a fresh Python enviroment into which `folium` has already been installed, identifies the packages that are loaded in when `folium` is loaded:\n", + "\n", + "```python\n", + "#https://stackoverflow.com/a/40381601/454773\n", + "import sys\n", + "before = [str(m) for m in sys.modules]\n", + "import folium\n", + "after = [str(m) for m in sys.modules]\n", + "set([m.split('.')[0] for m in after if not m in before and not m.startswith('_')])\n", + "```\n", + "\n", + "The loaded packages are:\n", + "\n", + "```\n", + "{'branca',\n", + " 'certifi',\n", + " 'chardet',\n", + " 'cmath',\n", + " 'csv',\n", + " 'dateutil',\n", + " 'encodings',\n", + " 'folium',\n", + " 'gzip',\n", + " 'http',\n", + " 'idna',\n", + " 'importlib',\n", + " 'jinja2',\n", + " 'markupsafe',\n", + " 'mmap',\n", + " 'numpy',\n", + " 'pandas',\n", + " 'pkg_resources',\n", + " 'pytz',\n", + " 'requests',\n", + " 'secrets',\n", + " 'stringprep',\n", + " 'urllib3',\n", + " 'zipfile'}\n", + " ```\n", + " " + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "The following packages seem to need installing in order load `folium`, along with folium itself:\n", + "\n", + "```\n", + "chardet, certifi, idna, branca, urllib3, Jinja2, requests, Markupsafe\n", + "```\n", + "\n", + "Universal wheels, with filenames of the form `PACKAGE-VERSION-py2.py3-none-any.whl` appearing in the *Download files* area of a PyPi package page ([example](https://pypi.org/project/requests/#files)] are required in order to install the package.\n", + "\n", + "One required package, [`Markupsafe`](https://pypi.org/project/Markupsafe/#files)) *did not* have a universal wheel available, so a wheel was manually built elsewhere (by hacking the [`setup.py` file](https://github.com/pallets/markupsafe/blob/main/setup.py) to force it to build the wheel in a platform and speedup free way) and pushed to a downloadable location in an [*ad hoc* wheelhouse](https://opencomputinglab.github.io/vce-wheelhouse/)." + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "# Install folium requirements\n", + "%pip install -q folium" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Demo of `folium` Map\n", + "\n", + "Load in the `folium` package:" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import folium" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "And render a demo map:" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "m = folium.Map(location=[50.693848, -1.304734], zoom_start=11)\n", + "m" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python (Pyodide)", + "language": "python", + "name": "python" + }, + "language_info": { + "codemirror_mode": { + "name": "python", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.8" + }, + "orig_nbformat": 4, + "toc-showcode": false + }, + "nbformat": 4, + "nbformat_minor": 4 +} diff --git a/content/pyodide/interactive-widgets.ipynb b/content/pyodide/interactive-widgets.ipynb new file mode 100644 index 0000000..267273d --- /dev/null +++ b/content/pyodide/interactive-widgets.ipynb @@ -0,0 +1,268 @@ +{ + "cells": [ + { + "cell_type": "markdown", + "id": "9ca234f7-84b7-4107-9bcd-74f5a4ffd07d", + "metadata": {}, + "source": [ + "# `ipywidgets` Interactive Demo\n", + "\n", + "Simple demonstration of rendering Interactive widgets in a `jupyterlite` notebook.\n", + "\n", + "`ipywidgets` can be installed in this deployment (it provides the @jupyter-widgets/jupyterlab-manager federated extension), but you will need to make your own deployment to have access to other interactive widgets libraries." + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "d62fba6e", + "metadata": {}, + "outputs": [], + "source": [ + "%pip install -q ipywidgets" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "3bab23f8-de91-43c9-9cec-84f4924425fc", + "metadata": {}, + "outputs": [], + "source": [ + "from ipywidgets import IntSlider" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "a15c5acb-ee72-4005-8761-5693db853f22", + "metadata": {}, + "outputs": [], + "source": [ + "slider = IntSlider()" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "8ba89682-e0d7-4bd2-961a-f9956850fd5a", + "metadata": {}, + "outputs": [], + "source": [ + "slider" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "50510ade-668f-4477-8cb2-41574609ac73", + "metadata": {}, + "outputs": [], + "source": [ + "slider" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "7bac1ed8-8c77-426b-a781-1c1a6cfad829", + "metadata": {}, + "outputs": [], + "source": [ + "slider.value" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "976a70a0-e99d-4c20-b005-f59bbba10f85", + "metadata": {}, + "outputs": [], + "source": [ + "slider.value = 5" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "3134c76e-cffb-4701-8230-e6c4bfbbfdb9", + "metadata": {}, + "outputs": [], + "source": [ + "from ipywidgets import IntText, link" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "f7b3fe0a-5695-4ef2-a573-40785e68fbae", + "metadata": {}, + "outputs": [], + "source": [ + "text = IntText()" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "5e2fd50e-19e0-4e20-a1f7-ad65400ec636", + "metadata": {}, + "outputs": [], + "source": [ + "text" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "bb3bedce-7311-48c0-aeab-8fe3aa554b92", + "metadata": {}, + "outputs": [], + "source": [ + "link((slider, 'value'), (text, 'value'));" + ] + }, + { + "cell_type": "markdown", + "id": "71b68c3e-184e-4320-9513-d0bc72800a85", + "metadata": {}, + "source": [ + "# `bqplot` Interactive Demo\n", + "\n", + "Plotting in JupyterLite\n", + "\n", + "`bqplot` can be installed in this deployment (it provides the bqplot federated extension), but you will need to make your own deployment to have access to other interactive widgets libraries." + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "119eb9a3-ac98-42c3-98d4-1ac460eb75d3", + "metadata": {}, + "outputs": [], + "source": [ + "%pip install -q bqplot" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "23b32857-2958-4083-b16a-ac26cd2408d4", + "metadata": {}, + "outputs": [], + "source": [ + "from bqplot import *\n", + "\n", + "import numpy as np\n", + "import pandas as pd\n", + "\n", + "np.random.seed(0)\n", + "\n", + "n = 100\n", + "\n", + "x = list(range(n))\n", + "y = np.cumsum(np.random.randn(n)) + 100.\n", + "\n", + "sc_x = LinearScale()\n", + "sc_y = LinearScale()\n", + "\n", + "lines = Lines(\n", + " x=x, y=y,\n", + " scales={'x': sc_x, 'y': sc_y}\n", + ")\n", + "ax_x = Axis(scale=sc_x, label='Index')\n", + "ax_y = Axis(scale=sc_y, orientation='vertical', label='lines')\n", + "\n", + "Figure(marks=[lines], axes=[ax_x, ax_y], title='Lines')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "ddb6b44e-06a0-4049-a79d-33ffc90d5a03", + "metadata": {}, + "outputs": [], + "source": [ + "lines.colors = ['green']" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "e367e7fb-b403-41aa-9629-224827ec3005", + "metadata": {}, + "outputs": [], + "source": [ + "lines.fill = 'bottom'" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "d4a167f3-07c4-4880-92f5-7fcdea0c61c6", + "metadata": {}, + "outputs": [], + "source": [ + "lines.marker = 'circle'" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "1d1342f7-ec08-4f53-84dc-d712226d9e46", + "metadata": {}, + "outputs": [], + "source": [ + "n = 100\n", + "\n", + "x = list(range(n))\n", + "y = np.cumsum(np.random.randn(n))\n", + "\n", + "sc_x = LinearScale()\n", + "sc_y = LinearScale()\n", + "\n", + "bars = Bars(\n", + " x=x, y=y,\n", + " scales={'x': sc_x, 'y': sc_y}\n", + ")\n", + "ax_x = Axis(scale=sc_x, label='Index')\n", + "ax_y = Axis(scale=sc_y, orientation='vertical', label='bars')\n", + "\n", + "Figure(marks=[bars], axes=[ax_x, ax_y], title='Bars', animation_duration=1000)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "f86bbcfb-5b02-4700-b8d6-f90068893b55", + "metadata": {}, + "outputs": [], + "source": [ + "bars.y = np.cumsum(np.random.randn(n))" + ] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python (Pyodide)", + "language": "python", + "name": "python" + }, + "language_info": { + "codemirror_mode": { + "name": "python", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.8" + }, + "orig_nbformat": 4, + "toc-showcode": false + }, + "nbformat": 4, + "nbformat_minor": 5 +} diff --git a/content/pyodide/ipycanvas.ipynb b/content/pyodide/ipycanvas.ipynb new file mode 100644 index 0000000..33e1b9a --- /dev/null +++ b/content/pyodide/ipycanvas.ipynb @@ -0,0 +1,178 @@ +{ + "cells": [ + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# ipycanvas: John Conway's Game Of Life" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "Some of the following code is adapted from https://jakevdp.github.io/blog/2013/08/07/conways-game-of-life/" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "%pip install -q ipycanvas" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import asyncio\n", + "\n", + "import numpy as np\n", + "\n", + "from ipycanvas import RoughCanvas, hold_canvas" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "def life_step(x):\n", + " \"\"\"Game of life step\"\"\"\n", + " nbrs_count = sum(np.roll(np.roll(x, i, 0), j, 1)\n", + " for i in (-1, 0, 1) for j in (-1, 0, 1)\n", + " if (i != 0 or j != 0))\n", + " return (nbrs_count == 3) | (x & (nbrs_count == 2))" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "def draw(x, canvas, color='black'):\n", + " with hold_canvas(canvas):\n", + " canvas.clear()\n", + " canvas.fill_style = '#FFF0C9'\n", + " canvas.rough_fill_style = 'solid'\n", + " canvas.fill_rect(-10, -10, canvas.width + 10, canvas.height + 10)\n", + " canvas.rough_fill_style = 'cross-hatch'\n", + "\n", + " canvas.fill_style = color\n", + " canvas.stroke_style = color\n", + "\n", + " living_cells = np.where(x)\n", + " \n", + " rects_x = living_cells[1] * n_pixels\n", + " rects_y = living_cells[0] * n_pixels\n", + "\n", + " canvas.fill_rects(rects_x, rects_y, n_pixels)\n", + " canvas.stroke_rects(rects_x, rects_y, n_pixels)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "glider_gun =\\\n", + "[[0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0],\n", + " [0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,0,1,0,0,0,0,0,0,0,0,0,0,0],\n", + " [0,0,0,0,0,0,0,0,0,0,0,0,1,1,0,0,0,0,0,0,1,1,0,0,0,0,0,0,0,0,0,0,0,0,1,1],\n", + " [0,0,0,0,0,0,0,0,0,0,0,1,0,0,0,1,0,0,0,0,1,1,0,0,0,0,0,0,0,0,0,0,0,0,1,1],\n", + " [1,1,0,0,0,0,0,0,0,0,1,0,0,0,0,0,1,0,0,0,1,1,0,0,0,0,0,0,0,0,0,0,0,0,0,0],\n", + " [1,1,0,0,0,0,0,0,0,0,1,0,0,0,1,0,1,1,0,0,0,0,1,0,1,0,0,0,0,0,0,0,0,0,0,0],\n", + " [0,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0,1,0,0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0],\n", + " [0,0,0,0,0,0,0,0,0,0,0,1,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0],\n", + " [0,0,0,0,0,0,0,0,0,0,0,0,1,1,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0]]\n", + "\n", + "x = np.zeros((50, 70), dtype=bool)\n", + "x[1:10,1:37] = glider_gun" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "n_pixels = 15\n", + "\n", + "canvas = RoughCanvas(width=x.shape[1]*n_pixels, height=x.shape[0]*n_pixels)\n", + "canvas.fill_style = '#FFF0C9'\n", + "canvas.rough_fill_style = 'solid'\n", + "canvas.fill_rect(0, 0, canvas.width, canvas.height)\n", + "\n", + "canvas" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "draw(x, canvas, '#5770B3')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "for _ in range(300):\n", + " x = life_step(x)\n", + " draw(x, canvas, '#5770B3')\n", + "\n", + " await asyncio.sleep(0.1)" + ] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python (Pyodide)", + "language": "python", + "name": "python" + }, + "language_info": { + "codemirror_mode": { + "name": "python", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.8" + }, + "orig_nbformat": 4, + "toc-showcode": false + }, + "nbformat": 4, + "nbformat_minor": 4 +} diff --git a/content/pyodide/ipyleaflet.ipynb b/content/pyodide/ipyleaflet.ipynb new file mode 100644 index 0000000..64dcff2 --- /dev/null +++ b/content/pyodide/ipyleaflet.ipynb @@ -0,0 +1,259 @@ +{ + "cells": [ + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "%pip install -q bqplot ipyleaflet" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "import os\n", + "from urllib.request import urlopen\n", + "import json\n", + "from datetime import datetime\n", + "\n", + "import numpy as np\n", + "import pandas as pd\n", + "\n", + "from js import fetch\n", + "\n", + "from ipywidgets import Dropdown\n", + "\n", + "from bqplot import Lines, Figure, LinearScale, DateScale, Axis\n", + "\n", + "from ipyleaflet import Map, GeoJSON, WidgetControl" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "URL = \"https://raw.githubusercontent.com/jupyter-widgets/ipyleaflet/master/examples/nations.json\"\n", + "\n", + "res = await fetch(URL)\n", + "text = await res.text()\n", + "\n", + "data = pd.read_json(text)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "def clean_data(data):\n", + " for column in ['income', 'lifeExpectancy', 'population']:\n", + " data = data.drop(data[data[column].apply(len) <= 4].index)\n", + " return data\n", + "\n", + "def extrap_interp(data):\n", + " data = np.array(data)\n", + " x_range = np.arange(1800, 2009, 1.)\n", + " y_range = np.interp(x_range, data[:, 0], data[:, 1])\n", + " return y_range\n", + "\n", + "def extrap_data(data):\n", + " for column in ['income', 'lifeExpectancy', 'population']:\n", + " data[column] = data[column].apply(extrap_interp)\n", + " return data" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "data = clean_data(data)\n", + "data = extrap_data(data)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "data" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "date_start = datetime(1800, 12, 31)\n", + "date_end = datetime(2009, 12, 31)\n", + "\n", + "date_scale = DateScale(min=date_start, max=date_end)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "date_data = pd.date_range(start=date_start, end=date_end, freq='A', normalize=True)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "country_name = 'Angola'\n", + "data_name = 'income'\n", + "\n", + "x_data = data[data.name == country_name][data_name].values[0]" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "x_scale = LinearScale()\n", + "\n", + "lines = Lines(x=date_data, y=x_data, scales={'x': date_scale, 'y': x_scale})\n", + "\n", + "ax_x = Axis(label='Year', scale=date_scale, num_ticks=10, tick_format='%Y')\n", + "ax_y = Axis(label=data_name.capitalize(), scale=x_scale, orientation='vertical', side='left')\n", + "\n", + "figure = Figure(axes=[ax_x, ax_y], title=country_name, marks=[lines], animation_duration=500,\n", + " layout={'max_height': '250px', 'max_width': '400px'})" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "def update_figure(country_name, data_name):\n", + " try:\n", + " lines.y = data[data.name == country_name][data_name].values[0]\n", + " ax_y.label = data_name.capitalize()\n", + " figure.title = country_name\n", + " except IndexError:\n", + " pass" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "URL = \"https://raw.githubusercontent.com/jupyter-widgets/ipyleaflet/master/examples/countries.geo.json\"\n", + "\n", + "res = await fetch(URL)\n", + "text = await res.text()\n", + "\n", + "countries = json.loads(text)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "m = Map(zoom=3)\n", + "\n", + "geo = GeoJSON(data=countries, style={'fillColor': 'white', 'weight': 0.5}, hover_style={'fillColor': '#1f77b4'}, name='Countries')\n", + "m.add_layer(geo)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "widget_control1 = WidgetControl(widget=figure, position='bottomright')\n", + "\n", + "m.add_control(widget_control1)\n", + "\n", + "def on_hover(event, feature, **kwargs):\n", + " global country_name\n", + "\n", + " country_name = feature['properties']['name']\n", + " update_figure(country_name, data_name)\n", + "\n", + "geo.on_hover(on_hover)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "dropdown = Dropdown(\n", + " options=['income', 'population', 'lifeExpectancy'],\n", + " value=data_name,\n", + " description='Plotting:'\n", + ")\n", + "\n", + "def on_click(change):\n", + " global data_name\n", + "\n", + " data_name = change['new']\n", + " update_figure(country_name, data_name)\n", + "\n", + "dropdown.observe(on_click, 'value')\n", + "\n", + "widget_control2 = WidgetControl(widget=dropdown, position='bottomleft')\n", + "\n", + "m.add_control(widget_control2)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "m" + ] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python (Pyodide)", + "language": "python", + "name": "python" + }, + "language_info": { + "codemirror_mode": { + "name": "python", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.8" + }, + "orig_nbformat": 4, + "toc-showcode": false + }, + "nbformat": 4, + "nbformat_minor": 4 +} diff --git a/content/pyodide/matplotlib.ipynb b/content/pyodide/matplotlib.ipynb new file mode 100644 index 0000000..c2ec2be --- /dev/null +++ b/content/pyodide/matplotlib.ipynb @@ -0,0 +1,113 @@ +{ + "cells": [ + { + "cell_type": "markdown", + "metadata": { + "tags": [] + }, + "source": [ + "## Matplotlib" + ] + }, + { + "cell_type": "code", + "execution_count": 1, + "metadata": {}, + "outputs": [], + "source": [ + "import numpy as np\n", + "import matplotlib.pyplot as plt" + ] + }, + { + "cell_type": "code", + "execution_count": 2, + "metadata": {}, + "outputs": [], + "source": [ + "x = np.linspace(0, 10, 1000)\n", + "plt.plot(x, np.sin(x));" + ] + }, + { + "cell_type": "code", + "execution_count": 3, + "metadata": {}, + "outputs": [ + { + "data": { + "image/png": "iVBORw0KGgoAAAANSUhEUgAAAoAAAAHgCAYAAAA10dzkAAAAOXRFWHRTb2Z0d2FyZQBNYXRwbG90bGliIHZlcnNpb24zLjMuMywgaHR0cHM6Ly9tYXRwbG90bGliLm9yZy/Il7ecAAAACXBIWXMAAA9hAAAPYQGoP6dpAABmgklEQVR4nO3deXxTZdo+8OskaZKuKd1baKGFQtkLRUrZkQoILoy4oDgogzg6OqPCjCPvb9R3RmcYfd3GZWQYZXDfxhVUFMsOZWspe0sXoPveJt2X5Pz+yAIVKKVNcpKc6/v55A/DSXqnwsl1zvM89yOIoiiCiIiIiGRDIXUBRERERORcDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMsMASERERCQzDIBEREREMqOSugB3ZjKZUFpaCn9/fwiCIHU5RERE1AOiKKKhoQFRUVFQKOR5L4wBsA9KS0sRHR0tdRlERETUC0VFRRgwYIDUZUiCAbAP/P39AZj/AgUEBEhcDREREfWEwWBAdHS07XtcjhgA+8A67BsQEMAASERE5GbkPH1LngPfRERERDLGAEhEREQkMwyARERERDLDAEhEREQkMwyARERERDLDAEhEREQkMwyARERERDLDAEhEREQkMwyARERERDLjFgFw586duPHGGxEVFQVBEPDVV19d8TXbt2/H+PHjodFoMGTIEGzYsOGiYz777DMkJCRAq9Vi9OjR+O677+xfPBEREZGLcYsA2NTUhLFjx+KNN97o0fFnzpzBggULMGvWLGRlZeHRRx/Ffffdhx9++MF2zN69e3HnnXdi+fLlOHz4MBYuXIiFCxfi+PHjjvoYRERERC5BEEVRlLqIqyEIAr788kssXLjwssf88Y9/xLffftslzC1evBj19fXYvHkzAOCOO+5AU1MTNm3aZDtm0qRJSExMxNq1a3tUi8FggE6ng16v517AREREboLf34BK6gIcIT09HampqV2emzt3Lh599NEux6xcufKiY7obXm5ra0NbW5vtvw0Gg13qpe7pWzqwv6AGOeUNKDO0oqPTBB+1EtFBPhgRFYCkgf2gUSmlLpOI3Fyn0YTDRfU4VqxHYW0zmto6oVIKiAjwxtBwP0yKC0Y/X7XUZRLZhUcGwPLycoSHh3d5Ljw8HAaDAS0tLfD29r7sMeXl5Zd93zVr1uDPf/6zQ2qmrkwmEWnZlfhg/znsPF0FUzf3qf01KswZGYHlU2MxIkqeV3JE1Hu5FQ3YsPcsNh4phaG187LHKQQgOTYYS1MGYs7ICCgVghOrJLIvjwyAjrJ69eoudw0NBgOio6MlrMgz7c2rxrPfnsLJsvN3WONCfDEuph/69/OG1kuBprZO5FU2IrOwHlUNbfg8sxifZxbjuhHheHLBCMQE+0j4CYjIHZTpW/D377PxdVap7blAHy8kxwZhUIgvArRe6DCaUFzXguMlemSXNyC9oAbpBTWIC/HFUzeOwMxhYRJ+AqLe88gAGBERgYqKii7PVVRUICAgAN7e3t0eExERcdn31Wg00Gg09i+YAABNbZ14ZtNJfHywCID5zt5dyTFYPDEGsSG+l3yNySTi0Lk6vLfvHDYdLcWWkxXYlVuF388ZhuVTYyEIvEInoq5EUcSnh4rwv9+cREuHEYIAzBkRjnsmD0JybPBl7+wV1Tbj00NFeDf9HAqqm3Dvfw5iwZhI/O0Xo6Hz9nLypyDqG48MgCkpKRe1dNmyZQtSUlK6HJOWltZlXuDPjyHnya9qxH3vHMKZ6iYIAvDLSQPxaOpQBF1hvo1CIWBibBAmxgbhkdlD8KevjmNfQS2e/fYUDpypxQu3j0WAlidmIjJraTfi8c+PYuMR812/pIH98L83jsToAborvjY6yAer5gzD/dPj8I+fcvGfvWfx7dEyHC2ux5tLkjCq/5Xfg8hVuMUq4MbGRuTl5QEAxo0bh5deegmzZs1CUFAQYmJisHr1apSUlODdd98FYG4DM2rUKDz00EP41a9+ha1bt+J3v/sdvv32W8ydOxeAuQ3MjBkz8Pe//x0LFizAxx9/jL/97W/IzMzEqFGjelQXVxHZx978ajzwXgYMrZ2I0mnx4u2JSBkc3Kv3EkUR7+8vxDMbT6LdaEJ8mB/eW56MCJ3WzlUTkbupbmzDfe8cQlZRPVQKAavmDMOvp8dB0cu5fEeK6vHQh5kormuBt5cS/7x7PGZxSNgt8PvbTQLg9u3bMWvWrIuev+eee7Bhwwbce++9OHv2LLZv397lNY899hhOnjyJAQMG4Mknn8S9997b5fWfffYZ/vSnP+Hs2bOIj4/H888/j/nz5/e4Lv4F6rtt2ZX49XsZaDeakDSwH9b9MgnBfn0fZj9SVI/73zuECkMb+gd644P7kjHoMsPIROT5Kg2tWLxuHwqqmxDo44V1v5yAibFBfX5ffXMHHv4oE7tyq6FUCHjp9rG4ObG/HSomR+L3t5sEQFfFv0B9sy2nEr9+1xz+5o4Mxz8Wj4PWy37tXIpqm/HLt/fjbE0zonRa/PfByYgK9Lbb+xORe6hpbMPidfuQW9mI/oHeeHf5RAwO9bPb+7d3mvDHz4/iy8MlUCoEvHHXOMwbFWm39yf74/e3m+wEQp7naHE9fvN+JtqNJlw/KgKv3zXeruEPMM/X+eyByYgL8UWpvhV3v7UfNY1tV34hEXmMhtYO3P32AeRWNiIiQIuPVkyya/gDALVKgRdvG4tbkwbAaBLx248OY3dutV1/BpG9MQCS0xXXNeNXGw6hpcOIafEhePXOcfBSOuavYqi/Bu/fl4z+gd4oqG7Cg+9nor3T5JCfRUSuxWgS8cjHWThVZkCInwYfrEh2WIsohULAc4vGYMGYSHQYRfzmgwwUVDU65GcR2QMDIDlVc3snlm84hOrGNiRE+OOfS8Y7LPxZRQV6451fXQN/jQoHztbiL5tOOPTnEZFreP6HbGzNroRGpcDb90yw+52/n1MqBLx421iMjwmEobUT971zCPrmDof+TKLeYgAkp3ryqxPIqWhAqL8G6++9Bv5OatEyJMwfryxOhCAA7+8rxEcHCp3yc4lIGpuOluJfOwoAAM/fOgZjowOd8nO1Xkr865cTEKXToqC6CY99mgVOtSdXxABITvPpoSJ8nlkMhQC8duc4py/ImD08HL+fMwwA8L/fnEBuRYNTfz4ROUdRbTNWf3EMAPDAjMFOX5Ub6q/Bv++ZALVKga3ZlfjPnrNO/flEPcEASE6RV9mIp74+DgBYed1QTIrrXZ+/vnpwxmBMHxqKtk4TfvdxFto6jZLUQUSO0Wk04dFPstDQ2onxMYH4/ZyhktQxMkqHPy0YDgD4+/fZOFGql6QOosthACSHM5pE/OG/R9DaYcK0+BD8ZuYQyWpRKAS8cOsYBPmqcarMgP/bnCNZLURkf29sy0fGuTr4a1T4x+JxUDl4jnF3fjlpIFKHh6PdaMLvPjqM1g5ecJLrYAAkh3t7dwEOF9bDX6PCc4vG9Lrrvr2EBWjxf7eOMde25wwyC+skrYeI7ON0RQNe35YLAHj2F6MQHeSYFb89JQgC/u/WMQj11yC/qgmvb82TtB6iCzEAkkPlVTbihR9PAwD+dMNwl2nEPHt4OBaNHwBRBFZ/foytYYjcnNEk4vH/HkWHUUTq8HDcNDZK6pIAAP181Xjm5pEAgLU78nGqzCBxRURmDIDkMKIo4smvjqO904TpQ0Nx+4RoqUvq4k8LhiPIV42cigas25kvdTlE1AfvpZ9FVlE9/DQqPLNwJARB2pGGC80bFYl5IyPQaRLxx8+PotPIC06SHgMgOcymo2VIL6iBRqXAXxeOcqkTMmC+Mn/qhhEAgFe35uFcTZPEFRFRb1Q2tOL/fjDP533i+gRE6lxjpOFCf7l5JAK0Khwt1rMNFbkEBkByiMa2Tjz77UkAwG9mDpF8Ls7l3JwYhWnxIWjvNOGv356Suhwi6oUXfshBU7sRY6MDcdfEGKnLuaSwAC1WWdpQvbjlNOqb2yWuiOSOAZAc4rWtuagwtCEmyAe/nhEndTmXJQgCnrphBJQKAT+erMCePO7fSeROjhXr8VlGMQDg6RtHSL7IrDtLkmMwLNwf9c0deGnLaanLIZljACS7K65rxn92nwUAPHXDCGi9lNIWdAXx4f745aSBAIC/bDzJ+TlEbkIURfx54wmIIrAwMQrjY/pJXVK3VEoFnr7RPO3k/X3nkF3OBSEkHQZAsruXtpxGu9GElLhgzB4eJnU5PfJoajwCfbyQU9GATw4VSV0OEfXAt8fKcOhcHbReCjw+L0Hqcnpk8pAQXD8qAiYReJ59SElCDIBkV6fKDPjycAkA82RsV1v4cTmBPmo8MjseAPBqWi4bthK5uA6jCS9YFn48MGOwy7SY6onH5yVAqRCwNbsSh87WSl0OyRQDINnV85uzIYrAgtGRTtt83V7uSo5B/0BvVBja8P6+c1KXQ0Td+DyjGGdrmhHsq8aKaa47z/hSYkN8cfuEAQDMdwFFUZS4IpIjBkCym30FNdiWUwWVQsDv5w6TupyrplEp8bvZ5m3q/rk9H41tnRJXRESX0tZpxKtp5h0/Hpw5GL4alcQVXb3fzY6HWqXAgbO12H66SupySIYYAMluXrasals8MRqxIb4SV9M7i8YPQGyIL2qb2rF+9xmpyyGiS/j4QBFK9a0ID9DgbssCLncTqfPGPSnm2v9vcw5MJt4FJOdiACS7OHCmFvvP1MJLKeA3M4dIXU6vqZQKPHbdUADAv3cWQN/cIXFFRHShlnYjXt9m3lP3t9fGu3yXge48OHMI/DQqnCwzYMupCqnLIZlhACS7eG2reTjm1qRot5qMfSk3jI5EQoQ/Gto68U76WanLIaILfHigEFUNbRjQz9vltpe8WkG+atwz2XwX8I1teZwLSE7FAEh9lllYh1251VApBPxm5mCpy+kzhULAg5bP8Z89Z9DczrmARK6gvdOEt3YVADDvMKRWuf9X2K+mxELrpcDRYj125bIRPTmP+//rIcm9ZpmM/Ytx/V12y7ertWB0JAYG+6CuuQMfHWBfQCJX8FVWCcr0rQjz12BRUn+py7GLYD8N7rRsX/eGZWibyBkYAKlPTpTqsS2nCgoBeGiW+879+zmVUoFfTzffBXxrVwHaO7k7CJGUTCYRa3fkAwDumxYLjcp95/793P3T4+ClFLD/TC37ApLTMABSn7y9y7xSdsGYKAxy05W/l7MoqT/C/DUo07fiK0tzayKSxo8ny1FQ1YQArcp2x8xTROq8cWuSuS/g67wLSE7CAEi9Vq5vxTdHSgEAK6bFSlyN/WlUSluD2bU78tmmgUgioijize3mu39LUwbBX+slcUX298CMwVAIwPacKuRWNEhdDskAAyD12rvpZ9FpEjFxUBDGDAiUuhyHuCs5Bv5aFQqqm7CDzVqJJHHwbB2OFOuhUSlw75RBUpfjEAODfXHdiHAAwPo9Z6UthmSBAZB6pbm9Ex/sLwQALPfAu39WvhoVFl9jbjWxfg8bQxNJYcNe87+9W8b3R4ifRuJqHGf5VPOIwxeZxahtape4GvJ0DIDUK//NKIa+pQMDg32QOjxc6nIcamnKICgEYFduNU5zaIbIqUrqW/DDCXOT5HsmD5K2GAe7ZlA/jO6vQ1unCR/u537k5FgMgHTVjCYRb1u2SVs+NRZKhSBxRY4VHeSDuSMjAJj7AhKR87yXfg5Gk4jJg4OREBEgdTkOJQgClk81j6i8m36O3QfIoRgA6aptza7EuZpm6Ly9bCvXPN2vLCflLzJLODRD5CQt7UZ8fNA81eReD7/7ZzV/dCTCAzSobGjDpqOlUpdDHsxtAuAbb7yBQYMGQavVIjk5GQcOHLjssffeey8EQbjoMXLkSNsxGzZsuOjPtVqtMz6K23tvn3loYvE10fBRqySuxjkmDDw/NPPRgUKpyyGSha+ySlDf3IHoIG/M9vCpJlZqlQJLUwYBMN8FJHIUtwiAn3zyCVauXImnn34amZmZGDt2LObOnYvKyspLHv+Pf/wDZWVltkdRURGCgoJw2223dTkuICCgy3HnzvEf25UU1jRjp2U17F3JntWLqzuCINjuQHy4vxBGtoQhcihRFLHBshr2npRBHj/V5EJ3XBMNL6WArKJ6HC/RS10OeSi3CIAvvfQSVqxYgWXLlmHEiBFYu3YtfHx8sH79+kser9PpEBERYXscOnQIdXV1WLZsWZfjBEHoclx4uDyuMPvigwPmkDx9aCgGBntW4+crWTAmEjpvL5TUt2BnLlvCEDnS/jO1yKlogI9aidsmREtdjlOF+Gkwb1QkAOBDjjiQg7h8AGxvb0dGRgZSU1NtzykUCqSmpiI9Pb1H7/H2228jNTUVAwcO7PJ8Y2MjBg4ciOjoaNx88804ceJEt+/T1tYGg8HQ5SEnbZ1GfHaoGACwREZ3/6y0XkosGm+e8/jBPp6UiRzJOtXi5sT+0Hl7XuPnK7GeY786XIKG1g6JqyFP5PIBsLq6Gkaj8aK7c+Hh4SgvL7/i60tLS/H999/jvvvu6/L8sGHDsH79enz99dd4//33YTKZMHnyZBQXF1/2vdasWQOdTmd7REfL66r0+2PlqG1qR6ROi9kJYVKXIwnrsPfW7AqU6VskrobIM9U1teP7Y+bz+10etu1bTyXHBmFwqC+a2434KouLQcj+XD4A9tU777yDwMBALFy4sMvzKSkpWLp0KRITEzFjxgx88cUXCA0Nxb/+9a/Lvtfq1auh1+ttj6KiIgdX71o+2G9d/BEDldLj/+pc0pAwPyTHBsEkAh8fkNf/fyJn+eJwCdqNJozqH4DRA3RSlyMJQRCwJNk8avXBvnMQRc47Jvty+W/xkJAQKJVKVFRUdHm+oqICERER3b5WFEWsX78ev/zlL6FWq7s91svLC+PGjUNe3uU34tZoNAgICOjykIvscgMOnq2DUiFg8UR53fn8uSWTzCflTw4WodPIPl1E9iSKom34906Z3v2zWjR+ALReCmSXNyCzsF7qcsjDuHwAVKvVSEpKQlpamu05k8mEtLQ0pKSkdPvaHTt2IC8vD8uXL7/izzEajTh27BgiIyP7XLMnst7tmjMiHOEB8m6XM3dkOIJ81Sg3tGJr9qVXohNR7xw6V4e8ykZ4eylx09goqcuRlM7HCzeOMf8OPtjHLhVkXy4fAAFg5cqV+Pe//4133nkHp06dwoMPPoimpibbqt7Vq1dj6dKlF73u7bffRnJyMkaNGnXRn/3lL3/Bjz/+iIKCAmRmZuLuu+/GuXPnLporSObFH19llQAwtyeQO41KidsmmBeDcIUekX19ZNlj/KaxUfDXym/xx89Z5x1/d7wMBi4GITtyiwB4xx134IUXXsBTTz2FxMREZGVlYfPmzbaFIWVlZSgs7PpFrNfr8fnnn1/27l9dXR1WrFiB4cOHY/78+TAYDNi7dy9GjBjh8M/jbtJOVaK+uQMRAVpMiw+VuhyXsPga80l55+kqVBhaJa6GyDPomzvw7bEyAMCdMuw0cCmJ0YEYEuaH1g4TvjtaJnU55EEEkTNLe81gMECn00Gv13v0fMB7/3MA23Oq8JuZg/H4vASpy3EZt765F4fO1eGJ6xPwwIzBUpdD5PbeTT+Lp74+gYQIf3z/yDQIgnyaP3fnXzvyseb7bCQN7IfPH5wsdTkeQS7f391xizuAJJ1yfatt5w+5NWO9Eus+yP/NKOYKPSI7+DzTPNXk9gnRDH8X+MW4/lAqBGScq0N+VaPU5ZCHYACkbn1xuBgmEbhmUD/Ehshr548rWTAmElovBfIqG3GkmNs1EfVFXmUjjhTVQ6UQcFOivBd//FxYgBYzhpqn3/w34/K9aomuBgMgXZYoiradP25L4t2/n/PXeuF6y3ZN/81gT0Civvgi03yumTksFCF+GomrcT23WUYcvsgs5l7kZBcMgHRZGefqcKa6Cd5eSswfw/Y4l2IdBv4mqxStHUaJqyFyTyaTiC8Pm4d/b7Fst0hdzR4ejn4+XqgwtGEX9yInO2AApMuyDjUsGBMJP41K4mpcU0pcMKJ0WhhaO7HlZMWVX0BEF9lXUIMyfSsCtCpcK9NtJq9ErVLg5sT+AIDPOAxMdsAASJfU1mm0tWO4ZXx/iatxXQqFgEUXLAYhoqtnXfxxw9goaL2UElfjuqz9R7ecrGBPQOozBkC6pG3ZVWho7UREgBaTYoOlLselLbIMWe3KrUJVQ5vE1RC5l6a2Tnx/3HyxuYgXm90aERmAoeF+aO80YfPxcqnLITfHAEiX9LVl54+bEqOgULAdQ3cGhfhibHQgTCLw7dFSqcshcis/nChHc7sRg4J9MD6mn9TluDRBEGzDwN9k8VxDfcMASBcxtHYgzbLH7c1sx9AjN1v2LP3mCE/KRFfji8zziz/Y++/KrPsj782vRiV3IaI+YACki2w+Xo72ThOGhPlhRKQ8O6RfrRvGREIhAJmF9SisaZa6HCK3UGloxZ78agDmZsd0ZdFBPhgfYx5x2Mit4agPGADpItbh34WJUbwi76GwAC0mDw4BAGzkMDBRj3x7rAyiCCQN7IfoIB+py3EbC8dZh4FLJK6E3BkDIHVRaWjF3vwaALDNNaGesQ7NfM2TMlGPbLRMmbiRfUavyvzRkVAqBBwp1uNMdZPU5ZCbYgCkLr45UgpRBMbHBPKK/CrNHRUBtVKB0xWNyC43SF0OkUsrqm1GZmE9FALYaP4qhfhpMHWIecSBF5zUWwyA1MXXlpVlCzkf56rpvL0wK8G8X+fXXKFH1C1rn9Hk2GCE+Wslrsb9WBfofZNVClHk1nB09RgAyaagqhHHSvRQKgTMH80r8t64aez5Fg0m7tdJdFm24d+x7DTQG3NGRkDrpUBBdROOleilLofcEAMg2XxrWVE2ZUgIN2PvpdnDw+CrVqKkvgWZhXVSl0PkkvKrGnGi1ACVQsC8URFSl+OW/DQqpA4PB8CegNQ7DIBkYx2SuYF3/3pN66XEXMsX2kb2BCS6JOu/janxIQjyVUtcjfu6YYz57un3x8s5DExXjQGQAJiHf7PLG6BSCJgzMlzqctzaDZYJ7d8fL+cwMNHPiKJ4wepfDv/2xcxhofCxjDhkFdVLXQ65GQZAAmAOKwAweUgIAn14Rd4XU4aEwF+jQmVDGzI4DEzUxamyBuRXNUGtUuA6Xmz2idZLiWsTwgAA3x1jU2i6OgyABOD8/L/5nI/TZxqVEteNMH+x8aRM1NUmS6P0WcNCEaD1krga97fAMmXnu2McBqarwwBIOFvdhJNlBigVAuaMZAC0h+stJ+XNHAYmshFF0TbasIDDv3Yxc1gYvL3Mw8BHi7kamHqOAZDw3XHzXarJg4M5IdtOpsWHwE+jQpm+FYc5N4cIAJBT0YAz1ebhX+vQJfWNt1qJa4dzGJiuHgMg2U4a7P1nP1ovJWZbTsrf86RMBMB8RxwAplsukMg+rMPA5r2VOeJAPcMAKHOFNc04XmIe/p3L4V+7sgZqtmggMrMGQJ5r7GvmsFBovRQormthU2jqMQZAmbP2/kuJ4/Cvvc0Yer5FwxHOzSGZO1PdZGs1ZV0kRfbho1ZdsBq4XOJqyF0wAMrc95b5f9eP5hW5vbFFA9F51rt/KYOD2WrKAebbVgNzGJh6hgFQxopqm3G0WA+FwCEZR1nAkzIRAGCz5WKT5xrHuDYhDFovBQprm3Gi1CB1OeQGGABl7IcT5ivy5Nhg7v3rINYWDcV1LTwpk2xZp0EIArjTkIP4qFWYHh8KANhyskLiasgdMADK2I8nzCeJuTwhO4y3WokZQ80n5R95UiaZ+sEy/HvNwCCE+WslrsZzWfu4Wi/uibrDAChTNY1tOHSuFgBwHYdkHMo64f1HnpRJpmyrf7nTkEPNTgiDUiEgu7wBhTXNUpdDLo4BUKbSsithEoFR/QPQP9Bb6nI82rU8KZOMVTW04aDlYnMeA6BD9fNVY+KgIADAjyd5wUndc5sA+MYbb2DQoEHQarVITk7GgQMHLnvs9u3bIQjCRY/y8q7/ID777DMkJCRAq9Vi9OjR+O677xz9MVyGdfh3zgiekB2NJ2WSsx9PlkMUgbEDdLzYdALrHEtOOaErcYsA+Mknn2DlypV4+umnkZmZibFjx2Lu3LmorKzs9nU5OTkoKyuzPcLCzm89tHfvXtx5551Yvnw5Dh8+jIULF2LhwoU4fvy4oz+O5FrajdidVwUA7MflJDwpk1z9YJ1rzLt/TmE9px86W4uaxjaJqyFX5hYB8KWXXsKKFSuwbNkyjBgxAmvXroWPjw/Wr1/f7evCwsIQERFheygU5z/uP/7xD8ybNw9/+MMfMHz4cDzzzDMYP348Xn/9dUd/HMntzK1Ca4cJ0UHeSIjwl7ocWeBJmeSoobUD6fnVADja4CwD+vlgZFQATKJ5qg/R5bh8AGxvb0dGRgZSU1NtzykUCqSmpiI9Pb3b1yYmJiIyMhLXXXcd9uzZ0+XP0tPTu7wnAMydO7fb92xra4PBYOjycEcXDv8KgiBxNfLAkzLJ0a7canQYRcSG+GJwqK/U5ciGNWxz4Rl1x+UDYHV1NYxGI8LDuw5VhoeHXzSnzyoyMhJr167F559/js8//xzR0dGYOXMmMjMzbceUl5df1XsCwJo1a6DT6WyP6OjoPnwyaXQaTdiabQ6AHP51Luvvmz26SC5+svxdTx0exotNJ5o7ynyu2Zlbjaa2TomrIVfl8gGwN4YNG4Zf//rXSEpKwuTJk7F+/XpMnjwZL7/8cp/ed/Xq1dDr9bZHUVGRnSp2nkPn6lDX3IF+Pl6YMLCf1OXIivWqfFduFVrajRJXQ+RYnUYTtuaY73anDufFpjMNC/dHTJAP2jtN2JVbJXU55KJcPgCGhIRAqVSioqLrXZOKigpERPR8TsnEiRORl5dn+++IiIirfk+NRoOAgIAuD3djHf6dPTwcKqXL/+/3KMMj/TGgnzdaO0zYyZMyebiMc3Wob+5AoI8Xknix6VSCIGCOrf8oRxzo0lw+AajVaiQlJSEtLc32nMlkQlpaGlJSUnr8PllZWYiMjLT9d0pKSpf3BIAtW7Zc1Xu6G1EUbW1IOPzrfOaTsnVuDk/K5Nl+OmX+O37tsDBebErAuitIWnYlOowmiashV6SSuoCeWLlyJe655x5MmDABEydOxCuvvIKmpiYsW7YMgHlotqSkBO+++y4A4JVXXkFsbCxGjhyJ1tZWvPXWW9i6dSt+/PFH23s+8sgjmDFjBl588UUsWLAAH3/8MQ4dOoR169ZJ8hmdIbu8AcV1LdB6KWx7RpJzzRkZjvV7ziAtuwKdRhO/GMkjiaJom+uayotNSSQN7IdgXzVqmtpx8EwtJg8JkbokcjFuEQDvuOMOVFVV4amnnkJ5eTkSExOxefNm2yKOsrIyFBYW2o5vb2/HqlWrUFJSAh8fH4wZMwY//fQTZs2aZTtm8uTJ+PDDD/GnP/0J//M//4P4+Hh89dVXGDVqlNM/n7NY7zpNiw+Ft1opcTXyNGFgP/Tz8UJdcwcOnavDpLhgqUsisrv8qiacrWmGWqnA9KG82JSCUiFgVkIY/ptRjK3ZlQyAdBFBFEVR6iLclcFggE6ng16vd4v5gDe8tgvHSwx4/tYxuH2C+61g9hQrP8nCF4dL8OvpcVg9f7jU5RDZ3Zvb8/Hc5mxMHxqKd381UepyZOv7Y2V48INMxIX4YuvvZ0pdjktxt+9vR+D4k0yU61txvMQAQTDvTUvSuXa4+ffPfoDkqazz/64bznONlKbGh8BLKaCgugkFVY1Sl0MuhgFQJrZZ2jEkRgcixE8jcTXyNi0+FCqFgLzKRpyraZK6HCK7qm5sQ2ZhHQBztwGSjr/WC8mx5mkmW3nBST/DACgT1n/81w7jFbnUdN5euGZQEACelMnzbM2uhCgCI6MCEBXoLXU5smcd8Uk7xXMNdcUAKAOtHUbszjXvx3kth2RcgvWkzABInub87h+8++cKZlvO+QfP1kLf0iFxNeRKGABlYP+ZWrR0GBERoMWISHlOdnU11iC+r6AGjdyqiTxEa4cRuywXm+w16hoGBvtiSJgfOk0idwWhLhgAZWCb5S7TrIRQ7sfpIuJCfDEo2AcdRhG7eVImD5FeUGO72BwZxYtNVzHbOuLAYWC6AAOghxNFEWnZlo78CbwidxWCINj+f3BuDnmK7baLzTBebLoQ65STbTmVMJrY+Y3MGAA9XH5VI4pqW6BWKTBlCJsOuxLr3JxtOZUw8aRMbk4URWy1dBuYNYzNn11J0sB+CNCqUNfcgcOWFdpEDIAeznp3KSUuGD5qt9j4RTauGRQEP40K1Y3tOFqil7ocoj7Jr2oyX2wqFZjCXSdcikqpwMxh7D9KXTEAejhb+xc2f3Y5apUC04eavyi3WhrnErmr7Za7f8lxQfDV8GLT1VhHHDgPkKwYAD2Y3rLfLMAA6Kps8wB5VU5uznqxOZO9Rl3SjKGhUCoE5FQ0oKi2WepyyAUwAHqwnblVMJpExIf5ITrIR+py6BJmDguFIAAnSg0o17dKXQ5RrzS0duDg2VoAnP/nqgJ91Ega2A/A+Z2hSN4YAD2YbfiXzZ9dVoifBonRgQDYFJrc1568GnQYRQwK9kFcqJ/U5dBlzOauIHQBBkAPZTSJtjk53P7Ntdl6dGVzHiC5J+u5hsO/rm1WwvkG9K0dRomrIakxAHqorKI61DV3IECrst32J9dk/dLcm1+Dtk6elMm9iKJoG1KcxbnGLi0+zA9ROi3aOk1IL6iRuhySGAOgh7IOJ84YFgaVkv+bXdmIyACE+GnQ3G7EobPs0UXu5WSZARWGNnh7KZEcGyR1OdQNQRAww3LBuSOHOxDJHZOBh9qabf7HfW0CJ2S7OoVCwIyh5v9P2zk5m9zMdkuQmDIkGFovpcTV0JXwXENWDIAeqMLQilNlBggCMD2eAdAdzLCsnNxxmlfl5F7Y/sW9TBkSDJVCwNmaZpytbpK6HJIQA6AH2mkJEWP66xDsp5G4GuqJ6fEhUAjA6YpGlNa3SF0OUY/UNbXbthbj/D/34K/1woRB5nnhvOCUNwZAD2T9R2291U+uL9BHbWsHs51zc8hN7MytgkkEhoX7o3+gt9TlUA9Z79ZyGFjeGAA9jNEkYlduNYDzw4rkHmYMtUzOPs2TMrkH68XKTM41diszLd8N6WwHI2sMgB7mSHE99C0d0Hl7YeyAQKnLoatgPSnvyatBe6dJ4mqIundhr9FZnP/nVoaF+yMiQIvWDhP2n6mVuhySCAOgh7Eu7Z8aH8L2L25mdH8dgnzVaGzrRGYh28GQaztWokddcwf8New16m4EgZ0HiAHQ42zn/D+3pVAImB4fAoDzAMn17bKcayYPCYYXLzbdjnXEgf0A5Yv/aj1IbVM7jhbXA2AAdFecnE3uwjrXeBpbTbmlKfEhUCkEFFQ3obCmWepySAIMgB5kV24VRBFIiPBHeIBW6nKoF6bFh0AQgOzyBlQYWqUuh+iSLpymwF6j7ilA64XxA63tYHjBKUcMgB7E1v6Fq3/dVrCfBmP66wBwaIZc1778GnSaRMQE+SAm2EfqcqiXrMPAnHIiTwyAHsJkErHztKX9C4d/3Zp1r87tvConF7Ur1xwYplnmrJJ7sn5X7M1nOxg5YgD0ECfLDKhubIOPWokJA7khuzuzXpXvyq1Gp5HtYMj17Mrj/D9PMCIyAGH+GrR0GHHwLNvByA0DoIewDv9OHhwCtYr/W93Z2AGBCPTxQkNrJw4X1UtdDlEXxXXNKKhqgkIAUgYHS10O9UHXdjAcBpYbJgUPwfl/nkOpEGx3VjgPkFzNbsvq38ToQOi8vSSuhvrK2nmA+wLLj9sEwDfeeAODBg2CVqtFcnIyDhw4cNljv/jiC1x33XUIDQ1FQEAAUlJS8MMPP3Q5ZsOGDRAEoctDq3XPlbOG1g5knjOvyJvBIRmPMNN6Vc55gORiOPzrWabGh0CpEJBX2YjiOraDkRO3CICffPIJVq5ciaeffhqZmZkYO3Ys5s6di8rKS3857ty5E9dddx2+++47ZGRkYNasWbjxxhtx+PDhLscFBASgrKzM9jh37pwzPo7d7c0zr8iLC/HlijwPMd0SAI+XGFDV0CZxNURmRpOIPbYAyAUgnkDn7YVx0YEAzvd2JHlwiwD40ksvYcWKFVi2bBlGjBiBtWvXwsfHB+vXr7/k8a+88goef/xxXHPNNYiPj8ff/vY3xMfHY+PGjV2OEwQBERERtkd4eLgzPo7dWXs4cfjXc4T6azAyKgAAbF+4RFI7XqJHvWX7t7GW0EDuz3o317q6m+TB5QNge3s7MjIykJqaantOoVAgNTUV6enpPXoPk8mEhoYGBAV1XR3b2NiIgQMHIjo6GjfffDNOnDjR7fu0tbXBYDB0eUhNFEXbPDG2f/Es1pPyTs7NIRex23IxkjKY2795kmlDzXdzd+dWw2gSJa6GnMXl/wVXV1fDaDRedHcuPDwc5eXlPXqPF154AY2Njbj99tttzw0bNgzr16/H119/jffffx8mkwmTJ09GcXHxZd9nzZo10Ol0tkd0dHTvPpQd5VU2olTfCo1KgUlxXJHnSaz7Au/MrYYo8qRM0rNejHD417OM6a9DgFYFQ2unbTtR8nwuHwD76sMPP8Sf//xnfPrppwgLC7M9n5KSgqVLlyIxMREzZszAF198gdDQUPzrX/+67HutXr0aer3e9igqKnLGR+iWdeVWclwwtF5Kiashe0oa1A9aLwWqG9uQXd4gdTkkc00XbP/GBSCeRaVUYMoQc6jnPED5cPkAGBISAqVSiYqKii7PV1RUICIiotvXfvzxx7jvvvvw6aefdhlCvhQvLy+MGzcOeXl5lz1Go9EgICCgy0Nq1gA4nVfkHkejUtru6nJuDklt/5kadBhFRAd5YyAXm3kcTjmRH5cPgGq1GklJSUhLS7M9ZzKZkJaWhpSUlMu+7qOPPsKyZcvw0UcfYcGCBVf8OUajEceOHUNkZKRd6naG1g4jDpwxd2+fzvl/Hml6/PldQYikZN1qclp8KARBkLgasjfrsP7honoYWjskroacweUDIACsXLkS//73v/HOO+/g1KlTePDBB9HU1IRly5YBMA/NLl261Hb8hx9+iKVLl+LFF19EcnIyysvLUV5eDr1ebzvmL3/5C3788UcUFBQgMzMTd999N86dO4f77rvP6Z+vtw6drUNbpwnhARrEh/lJXQ45wHTL5Oz9Z2q5VydJyrb/7xCONnii6CAfxIX4wmgSkZ5fI3U55ARuEQDvuOMOvPDCC3jqqaeQmJiIrKwsbN682bYwpKysDIWFhbbj161bh87OTjz00EOIjIy0PR555BHbMXV1dVixYgWGDx+O+fPnw2AwYO/evRgxYoTTP19v7cozn5CnDuEVuacaHOqHSJ0W7Z0m291eImcrrW9BvmX7t8mDGQA9lfUuIKecyINK6gJ66uGHH8bDDz98yT/bsGFDl//evn37Fd/v5Zdfxssvv2yHyqSzyzIkY71LRJ5HEARMiw/Bp4eKsSu3ikP9JAnr9m9jowOh8+H2b55qWnwo3kk/xyknMuEWdwDpYtWNbThZZu5DOIVDMh5tGucBksR2cvhXFiYNDoZKIeBcTTPO1TRJXQ45GAOgm7LuDjE8MgAhfhqJqyFHmjIkBIIAZJc3oNLQKnU5JDOmC7d/4x1oj+anUSFpYD8A5v6j5NkYAN2U9W4Q2794viBfNUb31wHgXUByvhOlBtQ1d8BPo0Iit3/zeNZpJrvYDsbjMQC6IVEUbXNypjIAygInZ5NUrMO/k+K4/ZscWM816fk16DCaJK6GHIn/mt1QXmUjyg3m7d+uGRR05ReQ27POA9ydVw0T9+okJ7JedHCxmTyMjNKhn48XGto6caSoXupyyIEYAN2QdRhwYmwQt3+TifEx/eCjVqK6sR2nyg1Sl0My0dzeiYxz3P5NTpQKwbawkPMAPRsDoBvabZmQPZUr8mRDrVIgxbYtHE/K5Bz7C2rRYRQxoJ83BnH7N9k4vwMRp5x4MgZAN9PeacK+AnOXdl6Ry4ttcjZPyuQktvYv8SFsNi8j0yzD/UeK6qFv5rZwnooB0M1kFtahud2IED81EiL8pS6HnMg6OfvgmTq0tHNbOHI862IzXmzKS6TOG/FhfjCJwJ58jjh4KgZAN2M9IU8ZEgKFglfkchIb4ov+gd5oN5qw/wz36iTHKtO3ILey0bL9W7DU5ZCTTeMwsMdjAHQztg3ZeUUuO4Ig2FZich4gOZr179joAYEI9FFLXA05m3UYeOfpaogiOw94IgZAN1Lf3I6jJXoAXAAiV9bgv5NNWsnBdrPZvKwlxwZBrVSgpL4FZ6q5LZwnYgB0I3vzayCKwNBwP0TotFKXQxKYPDgYCgHIrWxEmb5F6nLIQ5lMoq3bAEcb5MlHrcI1seZt4Tji4JkYAN2Idfh36hCekOUq0EeNMQMCAfCkTI5zssyA2qZ2+KqVGBcTKHU5JBHOA/RsDIBuQhRF7DxtvSLnkIycTY/nPEByLOvfrZTB3P5NzqzfNXvza9DeyW3hPA3/ZbuJszXNKKlvgZdSQHIct3+Ts2mWfoC7c6u4LRw5BBebEQAMjwhAiJ8aze1GHC6sk7ocsjMGQDex23JCThrYDz5qlcTVkJQSowPhp1GhrrkDJ8u4LRzZV0u7EYfOmr/sp3K0QdYUF2wLxxEHz8MA6CZ2sSErWXgpFZhk2RZuJ+fmkJ3tP1ODdqMJ/QO9ERfiK3U5JDHbPMA8BkBPwwDoBjqNJqTnW7d/4xU54Xw/wNM8KZN9nb/Y5PZvdL7l2NHietQ3t0tcDdkTA6AbOFJcj4a2TgT6eGFklE7qcsgFWK/KM87Vobm9U+JqyJNw/h9dKEKnxdBwP4iieTEIeQ4GQDew64Lt35Tc/o0ADAr2uWBbuFqpyyEPUWFoxemKRgjc/o0uYG09xnYwnoUB0A3YhmS4+wdZXLgt3G5OziY7sZ5rxvTXoZ8vt38jM24L55kYAF2cobUDWUX1ALgij7riVTnZG4d/6VIu3BbubE2z1OWQnTAAurj0/BoYTSLiQnwxoJ+P1OWQC5kyJBiCAJyuaESFoVXqcsjNmUyi7W4yLzbpQj5qFZIGWreF4wWnp2AAdHE8IdPlBPqoMaa/eVEQe3RRX50qN6CmqR0+aiXGx/STuhxyMdZhYJ5rPAcDoIvjhuzUHe7VSfZi2/4tLhhqFb8aqKtplikn6fk16DByWzhPwH/lLqyothlnqpugVAiYxO3f6BKsfSH35FVzWzjqE+tFBEcb6FJGRgWgn48XGts6ccQyL53cGwOgC7Pe/RsXHQh/rZfE1ZArGhfTDz5qJaob23GqnNvCUe+0tBtx0LL9G0cb6FIu3BZuJ4eBPQIDoAvbze3f6ArUKgVSLNvCsR0M9daBs7Vo7zQhSqfF4FBu/0aXNp1TTjwKA6CLMppE2x1ADslQd6x/Pzg5m3pr1+nzw7/c/o0ux3quOVJUD31Lh8TVUF8xALqo4yV66Fs64K9VYewAbv9Gl2e9Q3zgbC1aO4wSV0PuiIvNqCeiAr0xONQXJhFIz+cFp7tzmwD4xhtvYNCgQdBqtUhOTsaBAwe6PX779u0YP348NBoNhgwZgg0bNlx0zGeffYaEhARotVqMHj0a3333nYOqv3rWE/LkwcFQKd3mfxNJYHCoLyJ1WrR3mnCA28LRVao0tCK7vAGCANscL6LLOd95gAHQ3blFsvjkk0+wcuVKPP3008jMzMTYsWMxd+5cVFZWXvL4M2fOYMGCBZg1axaysrLw6KOP4r777sMPP/xgO2bv3r248847sXz5chw+fBgLFy7EwoULcfz4cWd9rG7ttA3J8IqcuicIgm01MOfm0NWyfpGP7q9DELd/oyuYxiknHsMtAuBLL72EFStWYNmyZRgxYgTWrl0LHx8frF+//pLHr127FrGxsXjxxRcxfPhwPPzww7j11lvx8ssv2475xz/+gXnz5uEPf/gDhg8fjmeeeQbjx4/H66+/7qyPdVlNbZ3ILDSvyJvO+X/UA7wqp96yzTXm3T/qgUlxwfBSCiisbca5miapy6E+cPkA2N7ejoyMDKSmptqeUygUSE1NRXp6+iVfk56e3uV4AJg7d26X43tyzM+1tbXBYDB0eTjC/jM16DCKiA7yxsBgrsijK5syJASCAGSXN6CygdvCUc+YTKLtooHz/6gnfDUqjIuxbgvHC0535vIBsLq6GkajEeHh4V2eDw8PR3l5+SVfU15efsnjDQYDWlpauj3mcu8JAGvWrIFOp7M9oqOje/ORrsj6j2rqEJ6QqWeCfNUYFWVeLLQnjydl6pns8gZUN7aZt38bGCh1OeQmpnPKiUdw+QDoSlavXg29Xm97FBUVOeTn3DkxBn+cl4CFiVEOeX/yTLZ2MKcZAKlndueZv8CTY4OgUSklrobchfVu8d78GnRyWzi3pZK6gCsJCQmBUqlERUVFl+crKioQERFxyddERERc8viAgAB4e3t3e8zl3hMANBoNNBpNbz7GVRka7o+h4f4O/znkWabFh+DN7fnYlVcNURTZz42uiMO/1Buj+uug8/aCvqUDR4r1SBrYT+qSqBdc/g6gWq1GUlIS0tLSbM+ZTCakpaUhJSXlkq9JSUnpcjwAbNmypcvxPTmGyJ0kDewHby8lqhrakFPRIHU55OJaO4zYb2kbNH0oF4BQzykVgm3REHcgcl8uHwABYOXKlfj3v/+Nd955B6dOncKDDz6IpqYmLFu2DIB5aHbp0qW24x944AEUFBTg8ccfR3Z2Nv75z3/i008/xWOPPWY75pFHHsHmzZvx4osvIjs7G//7v/+LQ4cO4eGHH3b65yOyB41KieS4IAAcBqYrO2jZ/i0iQIvBoX5Sl0NuZirnAbo9twiAd9xxB1544QU89dRTSExMRFZWFjZv3mxbxFFWVobCwkLb8bGxsfj222+xZcsWjB07Fi+++CLeeustzJ0713bM5MmT8eGHH2LdunUYO3Ys/vvf/+Krr77CqFGjnP75iOzFelW+iwtB6ArOD/9y+ze6etZzzeGiehhauS2cOxJEURSlLsJdGQwG6HQ66PV6BAQESF0OEU5XNGDOyzuhUSlw5Ok50HpxYj9d2rxXdiK7vAGv3jkON43lgjO6erNe2I4z1U1Y98skzBl5+fnzrojf325yB5CIeiY+zA/hARq0dZqQca5O6nLIRVU2nN/+jQ2gqbe4K4h7YwAk8iCCINj6R+7k3By6DGuvyJFRAdz+jXrNunp8N6ecuCUGQCIPY13RyYUgdDnWvxts/0J9MSkuCEqFgDPVTSiqbZa6HLpKDIBEHmaKZUjvZJkB1Y1tEldDrkYURdsioWnca5z6wF/rhfExgQA4DOyOGACJPEyInwYjIs2TmrktHP1cTkUDqhra4O2lZANf6jPrlBPrrjLkPhgAiTwQJ2fT5ViHf5PjuP0b9d00y5STPXk1MJrYVMSdMAASeSDr3K5duVVgpye6kHVxEOf/kT2M6a+Dv1YFfUsHjpXopS6HrgIDIJEHmjCoHzQqBSoMbcitbJS6HHIRrR1GHLBs/8b5f2QPKqUCUwZbF55xGNidMAASeSCtlxITYy3bwnEYmCwOna1DW6cJ4QEaxIdx+zeyD+swMHcgci8MgEQeavoFw8BEwPm/C9PiQ7n9G9nNNMtCkMxzdWhs65S4GuopBkAiD2XdrH1/QS3aOo0SV0Ou4ML9f4nsJSbYBwODfdBpErEvv0bqcqiHGACJPFRChD9C/DRo6TByWzhCVUMbTpYZAJzvFUlkL9YtBbkriPtgACTyUIIg2O707OY8QNm7cPu3ED+NxNWQp7GuKucWlO6DAZDIg7EfIFmdH/5l+xeyv5TBwVAIQEFVE0rqW6Quh3qAAZDIg1mHZY6X6lHb1C5xNSQVURQvWADC4V+yP523FxKjAwEAu3kX0C0wABJ5sLAALRIi/CGK3BZOzk5XNKKyoQ1aLwW3fyOHOT8MzHONO2AAJPJw54eBeVUuV9b/9xNjg6H14vZv5BjWc82evGpuC+cGGACJPNxUy1X57txqbgsnU9Y7MtM5/EsONDY6EP4aFeqbO3CilNvCuToGQCIPN3FQENQqBUr1rcivapK6HHKy1g4j9heYe7NNH8oFIOQ4XkoFJg0OBsCFZ+6AAZDIw3mrlbhmkHneF4eB5efg2Vq0dZoQEaDl9m/kcNM55cRtMAASycC0C4aBSV4u3P2D27+Ro1mnnGScq0NzO7eFc2UMgEQyYG0Hk15Qg/ZOk8TVkDPtPG1p/8LhX3KCQcE+GNDPGx1GEfsLaqUuh7rBAEgkAyMiAxDsq0ZzuxGHC7ktnFxUGlqRXd4AQTh/EUDkSOYdiLgriDtgACSSAYVCwFTuCiI71v/Xo/vrEOSrlrgakgtuQekeGACJZMJ6B2gXG0LLBnf/IClMtmwLl1vZiDI9t4VzVQyARDJhHZY5WlyP+mZuC+fpTCaR+/+SJAJ91Bg9IBAA7wK6MgZAIpmI0JnbgJi3hauRuhxysJNlBtQ0tcNXrcT4GG7/Rs41nVNOXB4DIJGM2NrB5HFytqezTsBPGRwMtYqnenIu65ST3XnVMHFbOJfEswKRjFjngu08zW3hPN2u0xz+JemMi+kHX7UStU3tOFlmkLocugQGQCIZSY4LgpdSQEl9C87WNEtdDjlIc3snDp0z92Dj9m8kBbVKgRRuC+fSGACJZMRHrcKEgUEAuFWTJ9tXUIMOo4gB/bwxKNhH6nJIps4PA/Nc44pcPgDW1tZiyZIlCAgIQGBgIJYvX47GxsbLHt/R0YE//vGPGD16NHx9fREVFYWlS5eitLS0y3EzZ86EIAhdHg888ICjPw6R5NgP0PPtvGD4l9u/kVSsu88cPFOHlnajxNXQz7l8AFyyZAlOnDiBLVu2YNOmTdi5cyfuv//+yx7f3NyMzMxMPPnkk8jMzMQXX3yBnJwc3HTTTRcdu2LFCpSVldkezz//vCM/CpFLmG6ZE5aeX4MOI7eF80TWu7szhrL/H0knLsQXUTot2o0mHDjLbeFcjUrqArpz6tQpbN68GQcPHsSECRMAAK+99hrmz5+PF154AVFRURe9RqfTYcuWLV2ee/311zFx4kQUFhYiJibG9ryPjw8iIiIc+yGIXMzIqAD08/FCXXMHsorqcc2gIKlLIjsqqW9BflUTFAKQMpgBkKRj3Rbuk0NF2HW6CjM4H9WluPQdwPT0dAQGBtrCHwCkpqZCoVBg//79PX4fvV4PQRAQGBjY5fkPPvgAISEhGDVqFFavXo3m5u4nxbe1tcFgMHR5ELkbhULAlCEcBvZUu06b7/4lRgdC5+0lcTUkd5xy4rpcOgCWl5cjLCysy3MqlQpBQUEoLy/v0Xu0trbij3/8I+68804EBATYnr/rrrvw/vvvY9u2bVi9ejXee+893H333d2+15o1a6DT6WyP6Ojoq/9QRC5gmu2kzMnZnsb6RcvVv+QKpgwJgSAAORUNqDS0Sl0OXUCSAPjEE09ctADj54/s7Ow+/5yOjg7cfvvtEEURb775Zpc/u//++zF37lyMHj0aS5Yswbvvvosvv/wS+fn5l32/1atXQ6/X2x5FRUV9rpFIClMt8wCPFNVD39IhcTVkL0aTiN157P9HriPIV43R/XUAeBfQ1UgyB3DVqlW49957uz0mLi4OERERqKys7PJ8Z2cnamtrrzh3zxr+zp07h61bt3a5+3cpycnJAIC8vDwMHjz4ksdoNBpoNJpu34fIHfQP9MbgUF/kVzUhPb8a80ZFSl0S2cHRYnOg99eqMHaATupyiACY28EcLdZjd141FiUNkLocspAkAIaGhiI09MpXpykpKaivr0dGRgaSkpIAAFu3boXJZLIFtkuxhr/c3Fxs27YNwcHBV/xZWVlZAIDISH4RkjxMiw9FflUTduYyAHoK6x2WqUNCoFK69AwfkpFp8aH45/Z87Mo1bwunULA1kStw6TPE8OHDMW/ePKxYsQIHDhzAnj178PDDD2Px4sVdVgAnJCTgyy+/BGAOf7feeisOHTqEDz74AEajEeXl5SgvL0d7ezsAID8/H8888wwyMjJw9uxZfPPNN1i6dCmmT5+OMWPGSPJZiZzNOg9wN4dlPMZOywIQDv+SKxk/MBDeXkpUN7Yhu7xB6nLIwqUDIGBeqZuQkIDZs2dj/vz5mDp1KtatW9flmJycHOj1egBASUkJvvnmGxQXFyMxMRGRkZG2x969ewEAarUaP/30E+bMmYOEhASsWrUKixYtwsaNG53++YikkhwXDJVCQGFtM87VNEldDvWRobUDh4vqAZwP90SuQKNSYlKcud0UdwVxHS7dBxAAgoKC8OGHH3Z7zIWb2g8aNOiKm9xHR0djx44ddqmPyF35aVQYP7AfDpypxa7cagwM9pW6JOqDPbnVMJpExIX4IjqI27+Ra5kWH4ptOVXYlVuN+6dfep49OZfL3wEkIseZNoTtYDzF9hzL7h/DOPxLrsd6V/rAmVq0dnBbOFfAAEgkY9a9Ovfm16CT28K5LVEUscMy/2/msLArHE3kfEPC/BARoEVbpwkHuS2cS2AAJJKx0f110Hl7oaG1E0eK66Uuh3opu7wB5YZWaL0USI7l1n7kegRBsO0KwoVnroEBkEjGlAoBUy3DwDtyOAzsrqzDvylxwdB6KSWuhujSrMPA1rvVJC0GQCKZm2mZM7aNAdBtbc8xN8yflcDhX3Jd0+NDIQjmO9Zl+hapy5E9BkAimbMuGjhWokdlA/fqdDcNrR3IOFcHAJg5lAGQXFc/XzXGRQcCOH/XmqTDAEgkc2H+WttenTtPc26Ou9mTV41OS/uXmGC2fyHXNsuySGlbduUVjiRHYwAkIsyyDQPzpOxutmWz/Qu5D+s0hT151WjrZDsYKTEAEhFmWK7Kd56uYjsYN8L2L+RuRkQGINRfg6Z2Iw6drZO6HFljACQiJEYHItDH3A4ms7Be6nKoh9j+hdyNQiFghqX/KIeBpcUASERQXnBS3s5hYLfB9i/kjqzzALezHYykGACJCMAFk7O5Os9tsP0LuaOp8SFQKgTkVTaiqLZZ6nJkiwGQiAAA04eae3SdKjOgXM92MK6O7V/IXem8vZA0sB8AjjhIiQGQiAAAQb5qJNp6dPGk7OrY/oXcGUccpMcASEQ21jtJbAfj+qzz/9j+hdzRrATz39u9+dVo7WA7GCkwABKRjfWkvCevBu2dbAfjqkRRtAVAtn8hdzQs3B+ROi1aO0zYV1AjdTmyxABIRDajonQI8VOjsa0Th87VSl0OXUZOBdu/kHsTBMF28cJt4aTBAEhENuYeXTwpuzq2fyFPwB2IpMUASERdWIeB2aTVdW09xfYv5P6mDAmBl1LAuZpmnKlukroc2WEAJKIupg0JhVIhILeyEcV17NHlauqa2m3D89cyAJIb89WoMNEyhYEXnM7HAEhEXeh8vDA+JhAAh4Fd0fbTlTCJQEKEPwb0Y/sXcm/n28EwADobAyARXcQ6OZtX5a4nzTL8O3s47/6R+7Oea/YX1KK5vVPiauSFAZCILmINF7vzqtHSzh5drqLDaMIOy/6ps4eHS1wNUd8NDvVFdJA32o0m7M6tlrocWWEAJKKLDAv3R/9Ab7R1mrAnjydlV3HwTC0aWjsR7KtG4oBAqcsh6jNBEJBquZj56VSFxNXICwMgEV1EEARcN4InZVeTln1+9a9CIUhcDZF9WAPg1uxKmEyixNXIBwMgEV2SdRj4p1M8KbsCURSRZgnjqZz/Rx5kYmwQ/LUqVDe2I6u4XupyZIMBkIguKTk2GH4aFaob23C0RC91ObJXUN2EszXNUCsVmBrP/X/Jc3gpFbbFID+d5IiDszAAEtElqVUKzBhqDho8KUvPevcvOS4IfhqVxNUQ2VeqbcSB5xpnYQAkostKHcGTsqv4ydL+JZWrf8kDzRwaBqVCwOmKRhTWsAG9MzAAEtFlzRwaBoUAZJc3cFcQCdU3tyPjXB0A7v5Bnknn44WJg8y7gvCC0zkYAInosvr5qjHBclK2NiAm59txugpGk4hh4f6IDuLuH+SZZnMY2KlcPgDW1tZiyZIlCAgIQGBgIJYvX47GxsZuX3PvvfdCEIQuj3nz5nU5prW1FQ899BCCg4Ph5+eHRYsWoaKCf+mIfo5zc6RnHf69lqt/yYNZW08dOFMLfUuHxNV4PpcPgEuWLMGJEyewZcsWbNq0CTt37sT9999/xdfNmzcPZWVltsdHH33U5c8fe+wxbNy4EZ999hl27NiB0tJS3HLLLY76GERuyzrnbF9BDRpaeVJ2tg6jCTtyrPP/GADJcw0M9kV8mB86TaJtxxtyHJcOgKdOncLmzZvx1ltvITk5GVOnTsVrr72Gjz/+GKWlpd2+VqPRICIiwvbo16+f7c/0ej3efvttvPTSS7j22muRlJSE//znP9i7dy/27dvn6I9F5FbiQv0QF+KLDqOInae5K4izHThTC4N194/ofld+AZEbs25xyM4DjufSATA9PR2BgYGYMGGC7bnU1FQoFArs37+/29du374dYWFhGDZsGB588EHU1NTY/iwjIwMdHR1ITU21PZeQkICYmBikp6df9j3b2tpgMBi6PIjkIJW7gkjmhxPlAMx3YpXc/YM83HWWzgPbcirRYTRJXI1nc+kAWF5ejrCwrkMeKpUKQUFBKC8vv+zr5s2bh3fffRdpaWl47rnnsGPHDlx//fUwGo2291Wr1QgMDOzyuvDw8G7fd82aNdDpdLZHdHR07z8ckRuxDgNvy6lEJ0/KTmMyifjxhDl0zx3F9i/k+RKj+yHYV42G1k4cPFMrdTkeTZIA+MQTT1y0SOPnj+zs7F6//+LFi3HTTTdh9OjRWLhwITZt2oSDBw9i+/btfap79erV0Ov1tkdRUVGf3o/IXYyPCUSgjxfqmztwyNKOhBzvaIke5YZW+KqVmDw4ROpyiBxOqRAwy9LqaAtHHBxKkgC4atUqnDp1qttHXFwcIiIiUFnZtfVEZ2cnamtrERER0eOfFxcXh5CQEOTl5QEAIiIi0N7ejvr6+i7HVVRUdPu+Go0GAQEBXR5EcqBSKjA7wXwHyjokSY73o+V3PXNYGLReSomrIXIO62rgH09UQBS5D7mjSLKfUGhoKEJDr7yXZUpKCurr65GRkYGkpCQAwNatW2EymZCcnNzjn1dcXIyamhpERkYCAJKSkuDl5YW0tDQsWrQIAJCTk4PCwkKkpKT04hMReb55oyLweWYxfjhejqduGAFB4Hw0R7OG7TkjOfxL8jE9PhRaLwVK6ltwotSAUf11UpfkkVx6DuDw4cMxb948rFixAgcOHMCePXvw8MMPY/HixYiKirIdl5CQgC+//BIA0NjYiD/84Q/Yt28fzp49i7S0NNx8880YMmQI5s6dCwDQ6XRYvnw5Vq5ciW3btiEjIwPLli1DSkoKJk2aJMlnJXJ10+JD4KNWolTfimMleqnL8Xh5lY3Ir2qCl/L8kBiRHHirlZgeb75J9CNXAzuMSwdAAPjggw+QkJCA2bNnY/78+Zg6dSrWrVvX5ZicnBzo9eYvJKVSiaNHj+Kmm27C0KFDsXz5ciQlJWHXrl3QaDS217z88su44YYbsGjRIkyfPh0RERH44osvnPrZiNyJ1ktpCyKbj3MY2NGsd/9SBocgQOslcTVEzjV3pHk61o+ccuIwgsgB9l4zGAzQ6XTQ6/WcD0iysPFIKX770WHEhfgibdUMDgM70M2v78aRYj3++otRWJI8UOpyiJyqvrkdSc/+BKNJxI4/zMTAYF+7vj+/v93gDiARuY5ZCWFQKxUoqG5CbmX3WzJS75XpW3CkWA9BOD8hnkhOAn3UmBRn3oecC88cgwGQiHrMT6PCtHhzOxIOAzvOFsu8p3HRgQjz10pcDZE05oyIwIB+3lwB7yAMgER0VeaOMs/NYQB0HOsdD+s8KCI5uis5Brsen4WlKYOkLsUjMQAS0VWxbkl2ssyAwppmqcvxOPXN7dhXYN4BgQGQ5MxLqeA8YwdiACSiqxLkq0ZyLOfmOMqPJypgNIlIiPDHoBD7TnwnIrJiACSiqzbPOgzMAGh33x4rAwDMHx0pcSVE5MkYAInoqs0ZYQ6AGefqUGFolbgaz1Hf3I49edUAGACJyLEYAInoqkXotBgXEwiAi0Hs6ccTFei0DP8OCfOTuhwi8mAMgETUKwssd6g2HS2VuBLPYR3+XcC7f0TkYAyARNQrC8aYQ8rBs3Uo07dIXI376zL8O4YBkIgciwGQiHolUueNiYPMq4G/PVomcTXu78Lh38GhHP4lIsdiACSiXrthrPlO1UYGwD7bZBn+vYF3/4jICRgAiajXrh8VCYUAHCmqR1Etm0L3Vn1zO/Zy9S8ROREDIBH1Wqi/BpPiggEAm3gXsNesw7/DIwMQx+FfInICBkAi6pMbxkQB4Grgvtho+d0tGM2t34jIORgAiahP5o2KgFIh4ESpAQVVjVKX43YqG1ptq3+tYZqIyNEYAImoT4J81ZgyJAQAh4F7Y9ORMphEIDE6kHv/EpHTMAASUZ9ZV65uPFIKURQlrsa9fJ1VAgD4xbj+EldCRHLCAEhEfTZ3ZATUKgVyKxtxotQgdTluo6CqEUeK9VAqBFtjbSIiZ2AAJKI+03l7IXV4GADgy8MlElfjPr7KMi/+mBYfghA/jcTVEJGcMAASkV38YtwAAMDXWaXoNJokrsb1iaLI4V8ikgwDIBHZxYyhoQjyVaO6sQ27Lata6fIOF9XjXE0zfNRKXDciXOpyiEhmGACJyC7UKgVutMxj4zDwlX1t+R3NGREOH7VK4mqISG4YAInIbn4x3jwM/MOJcjS2dUpcjevqMJpsLXMWcviXiCTAAEhEdjN2gA5xIb5o7TDh+2PsCXg5u3OrUdPUjhA/NaZaeigSETkTAyAR2Y0gCLYFDRwGvrzPMooAADeOjYJKydMwETkfzzxEZFfWIc30ghqU1rdIXI3rqW1qx5aTFQCA25KiJa6GiOSKAZCI7Co6yAcTY4MgirwLeClfHS5Bh1HE6P46jIgKkLocIpIpBkAisrtbk8yLQT49VMSt4S4giiI+PWQe/r19wgCJqyEiOWMAJCK7u2FMJPw0Kpyraca+glqpy3EZx0sMyC5vgFqlwE1jufqXiKTDAEhEduejVuGmxCgAwMcHCyWuxnVYF3/MGxkBnY+XxNUQkZy5fACsra3FkiVLEBAQgMDAQCxfvhyNjY3dvkYQhEs+/u///s92zMyZMy/68wceeMDRH4dINhZfY17g8P3xctQ3t0tcjfRaO4z4yjIn8vYJXPxBRNJy+QC4ZMkSnDhxAlu2bMGmTZuwc+dO3H///d2+pqysrMtj/fr1EAQBixYt6nLcihUruhz3/PPPO/KjEMnK6P46jIgMQHuniYtBAPx4sgKG1k70D/TG5MHBUpdDRDLn0gHw1KlT2Lx5M9566y0kJydj6tSpeO211/Dxxx+jtLT0sq+LiIjo8vj6668xa9YsxMXFdTnOx8eny3EBAVyRR2QvgiBg8UTzna6PD3AxyAf7zgEwL5BRKASJqyEiuXPpAJieno7AwEBMmDDB9lxqaioUCgX279/fo/eoqKjAt99+i+XLl1/0Zx988AFCQkIwatQorF69Gs3Nzd2+V1tbGwwGQ5cHEV3ezYn9oVEpkFPRgCPFeqnLkczpigbsP1MLpeJ8KCYikpJLB8Dy8nKEhYV1eU6lUiEoKAjl5eU9eo933nkH/v7+uOWWW7o8f9ddd+H999/Htm3bsHr1arz33nu4++67u32vNWvWQKfT2R7R0TyRE3VH5+2FBaMjAQAf7ZfvYhDr3b/rhocjUuctcTVERBIFwCeeeOKyCzWsj+zsbLv8rPXr12PJkiXQarVdnr///vsxd+5cjB49GkuWLMG7776LL7/8Evn5+Zd9r9WrV0Ov19seRUVFdqmRyJPdlRwDAPj6SIksF4M0tXXi80zzHMi7Jw2UuBoiIjOVFD901apVuPfee7s9Ji4uDhEREaisrOzyfGdnJ2praxEREXHFn7Nr1y7k5OTgk08+ueKxycnJAIC8vDwMHjz4ksdoNBpoNJorvhcRnZc0sB9GRAbgZJkBnxwswq9nXPrfl6f6KqsEjW2diAvx5eIPInIZkgTA0NBQhIaGXvG4lJQU1NfXIyMjA0lJSQCArVu3wmQy2QJbd95++20kJSVh7NixVzw2KysLABAZGXnFY4mo5wRBwL2TB+Hxz4/ivX3ncN+0OChlsghCFEW8l24e/r0rOYaLP4jIZbj0HMDhw4dj3rx5WLFiBQ4cOIA9e/bg4YcfxuLFixEVFWU7LiEhAV9++WWX1xoMBnz22We47777Lnrf/Px8PPPMM8jIyMDZs2fxzTffYOnSpZg+fTrGjBnj8M9FJDc3JUYh0McLxXUtSDtVIXU5TpNZWIfs8gZovRS4LYlzhonIdbh0AATMK3UTEhIwe/ZszJ8/H1OnTsW6deu6HJOTkwO9vusKw48//hiiKOLOO++86D3VajV++uknzJkzBwkJCVi1ahUWLVqEjRs3OvSzEMmV1kuJOyyNod9JPyttMU70zl7z3b+bxkZx5w8icimCKPfmXH1gMBig0+mg1+vZQ5DoCorrmjH9+W0wicCWx6YjPtxf6pIcqrS+BdOe3wajScSm307FqP46qUsiIgt+f7vBHUAi8gwD+vkgdXg4AHncBXxn71kYTSJS4oIZ/ojI5TAAEpHT3Dt5EADg84wS1DV5bkuYxrZOfHjA3PfwvmmxEldDRHQxBkAicpqUwcEYGRWAlg6jR98F/ORgERpaOxEX6otZw8Ku/AIiIidjACQipxEEAQ9Y+gC+s/csWtqNEldkf51GE/6z5wwA4L6pcWz9QkQuiQGQiJzq+lERiA7yRl1zBz495Hm76Xx/vBzFdS0I8lXjlvH9pS6HiOiSGACJyKlUSgXunxYHAPj3rgJ0Gk0SV2Q/JpOI17fmAQCWpgyE1kspcUVERJfGAEhETnfbhGgE+6pRXNeCb4+VSV2O3Ww5VYGcigb4aVRYNpmLP4jIdTEAEpHTab2UWDZlEADgta15MJrcvx2pKIp4bWsuAOCeyQPZ+JmIXBoDIBFJ4p7Jg6Dz9kJeZSM2HS2Vupw+255TheMlBviolVg+NU7qcoiIusUASESS8Nd64f7p5qD0j59y3XouoCiKeNVy9+/uSQMR5KuWuCIiou4xABKRZO6ZPAj9fLxQUN2Er7Pc9y7gtpxKHC6sh0alYONnInILDIBEJBk/jQr3Tzf3BXx1q3veBTSaRDz3fQ4A4N4pgxDmr5W4IiKiK2MAJCJJLU0ZiGBfNc7VNOOjg+7XF/CrwyXIqWhAgFaF38wYInU5REQ9wgBIRJLy1ajwu9nxAIBXtpxGQ2uHxBX1XGuHES9tOQ0A+M2sIVz5S0RugwGQiCR3V3IM4kJ9UdPUjn9uz5e6nB57f985lNS3ICJAi3snD5K6HCKiHmMAJCLJeSkV+H/zhwMA3t59BkW1zRJXdGXVjW14Nc288vex6+K56wcRuRUGQCJyCdcmhGHy4GC0d5rw3OZsqcu5ouc3Z8PQ2omRUQG4NSla6nKIiK4KAyARuQRBEPD/FgyHIACbjpZhT1611CVd1uHCOnx6qBgA8JebR0KpECSuiIjo6jAAEpHLGBmlwz0pgwAA/+/LY2jtMEpb0CUYTSKe+voEAGDR+AFIGhgkcUVERFePAZCIXMqqOUMRHqDB2ZpmvLEtT+pyLvLWrgIcK9HDX6vCE9cnSF0OEVGvMAASkUvx13rhzzeNBACs3ZGPU2UGiSs6L7+qES9a2r48uWAEQv01EldERNQ7DIBE5HLmjozAdSPC0WEU8dgnWS4xFGw0iXj8v0fR3mnC9KGhuG3CAKlLIiLqNQZAInI5giBgzS2jEeKnRnZ5A174IUfqkvDm9jxknKuDn0aFNbeMhiBw4QcRuS8GQCJySSF+Gjy3aAwA4K3dZ7Art0qyWvYV1Nh2/Hj6xhHoH+gtWS1ERPbAAEhELmv28HAsSY4BAPzuo8OSNIiuaWzDIx8fhkkEbhnfH7dNYM8/InJ/DIBE5NKevGEExgzQoa65A79+LwMt7c6bD9jWacSD72eiwtCGwaG+eObmUU772UREjsQASEQuTeulxNq7kxDsq8bJMgNWfZYFo0l0+M8VRRFPfH4MB87Wwl+jwpt3J8FXo3L4zyUicgYGQCJyeVGB3nhjyXh4KQV8d6wcf/rqOETRsSHwpS2n8eXhEigVAv5593gMDfd36M8jInImBkAicguT4oLxj8XjoBCAjw4U4u/fZzssBP7jp1y8ttXchPrZhaMwLT7UIT+HiEgqDIBE5Dbmj47E334xGgDwr50F+NNXx+06HGwyiXh+czZe/sm84veP8xJw58QYu70/EZGr4IQWInIriyfGoNMk4smvj+OD/YWoMLThxdvHQuft1af3be0w4g//PYqNR0oBmMPfgzMH26NkIiKX4/J3AP/6179i8uTJ8PHxQWBgYI9eI4oinnrqKURGRsLb2xupqanIzc3tckxrayseeughBAcHw8/PD4sWLUJFRYUDPgER2dvdkwbi9TvHQ61U4KdTFbjp9d04XFjX6/c7WWrAja/txsYjpVApBDx/6xiGPyLyaC4fANvb23HbbbfhwQcf7PFrnn/+ebz66qtYu3Yt9u/fD19fX8ydOxetra22Yx577DFs3LgRn332GXbs2IHS0lLccsstjvgIROQAC8ZE4r8PpqB/oDfO1TTjljf34smvjqO6sa3H76Fv7sCzm07i5jd2I7eyEaH+Gry3PBm3s9cfEXk4QXT0Ujo72bBhAx599FHU19d3e5woioiKisKqVavw+9//HgCg1+sRHh6ODRs2YPHixdDr9QgNDcWHH36IW2+9FQCQnZ2N4cOHIz09HZMmTepRTQaDATqdDnq9HgEBAX36fETUO/XN7fjzxpP48nAJAECjUuDWpAG4ObE/kgb2g1LRdcs2o0nEsRI9vsgsxheZJWhs6wQAzBkRjjW3jEawn8bpn4GInIvf3x44B/DMmTMoLy9Hamqq7TmdTofk5GSkp6dj8eLFyMjIQEdHR5djEhISEBMT020AbGtrQ1vb+bsLBoPBcR+EiHok0EeNl+9IxG1JA/DcDzk4UlSPD/YX4oP9hfBVKzE0wh8hfhooBQGVDa3Iq2yEobXT9vph4f74nwXDMWMoV/oSkXx4XAAsLy8HAISHh3d5Pjw83PZn5eXlUKvVF80pvPCYS1mzZg3+/Oc/27dgIrKLyUNC8NXgYKTn1+DzzBJsOVkOQ2snDhfWX3Ssv1aF6fGhWDwxGlMGh0Dxs7uERESeTpIA+MQTT+C5557r9phTp04hISHBSRX1zOrVq7Fy5UrbfxsMBkRHc64QkasQBAGTh4Rg8pAQdBpH40x1E3IqGmBo6USnyYQQPw1ignyQEOEPldLlp0ATETmMJAFw1apVuPfee7s9Ji4urlfvHRERAQCoqKhAZGSk7fmKigokJibajmlvb0d9fX2Xu4AVFRW211+KRqOBRsP5QUTuQKVUID7cH/HcwYOI6CKSBMDQ0FCEhjpmvk1sbCwiIiKQlpZmC3wGgwH79++3rSROSkqCl5cX0tLSsGjRIgBATk4OCgsLkZKS4pC6iIiIiFyFy88BLCwsRG1tLQoLC2E0GpGVlQUAGDJkCPz8/ACYF3CsWbMGv/jFLyAIAh599FE8++yziI+PR2xsLJ588klERUVh4cKFAMyLQpYvX46VK1ciKCgIAQEB+O1vf4uUlJQerwAmIiIiclcuHwCfeuopvPPOO7b/HjduHABg27ZtmDlzJgDz3Tu9Xm875vHHH0dTUxPuv/9+1NfXY+rUqdi8eTO0Wq3tmJdffhkKhQKLFi1CW1sb5s6di3/+85/O+VBEREREEnKbPoCuiH2EiIiI3A+/v91gJxAiIiIisi8GQCIiIiKZYQAkIiIikhkGQCIiIiKZYQAkIiIikhkGQCIiIiKZYQAkIiIikhkGQCIiIiKZYQAkIiIikhmX3wrOlVk3UTEYDBJXQkRERD1l/d6W82ZoDIB90NDQAACIjo6WuBIiIiK6Wg0NDdDpdFKXIQnuBdwHJpMJpaWl8Pf3hyAIdn1vg8GA6OhoFBUVyXafQmfg79k5+Ht2Dv6enYO/Z+dw5O9ZFEU0NDQgKioKCoU8Z8PxDmAfKBQKDBgwwKE/IyAggCcYJ+Dv2Tn4e3YO/p6dg79n53DU71mud/6s5Bl7iYiIiGSMAZCIiIhIZhgAXZRGo8HTTz8NjUYjdSkejb9n5+Dv2Tn4e3YO/p6dg79nx+IiECIiIiKZ4R1AIiIiIplhACQiIiKSGQZAIiIiIplhACQiIiKSGQZAF/TGG29g0KBB0Gq1SE5OxoEDB6QuyaOsWbMG11xzDfz9/REWFoaFCxciJydH6rI83t///ncIgoBHH31U6lI8UklJCe6++24EBwfD29sbo0ePxqFDh6Quy6MYjUY8+eSTiI2Nhbe3NwYPHoxnnnlG1vvJ2sPOnTtx4403IioqCoIg4Kuvvury56Io4qmnnkJkZCS8vb2RmpqK3NxcaYr1IAyALuaTTz7BypUr8fTTTyMzMxNjx47F3LlzUVlZKXVpHmPHjh146KGHsG/fPmzZsgUdHR2YM2cOmpqapC7NYx08eBD/+te/MGbMGKlL8Uh1dXWYMmUKvLy88P333+PkyZN48cUX0a9fP6lL8yjPPfcc3nzzTbz++us4deoUnnvuOTz//PN47bXXpC7NrTU1NWHs2LF44403Lvnnzz//PF599VWsXbsW+/fvh6+vL+bOnYvW1lYnV+pZ2AbGxSQnJ+Oaa67B66+/DsC833B0dDR++9vf4oknnpC4Os9UVVWFsLAw7NixA9OnT5e6HI/T2NiI8ePH45///CeeffZZJCYm4pVXXpG6LI/yxBNPYM+ePdi1a5fUpXi0G264AeHh4Xj77bdtzy1atAje3t54//33JazMcwiCgC+//BILFy4EYL77FxUVhVWrVuH3v/89AECv1yM8PBwbNmzA4sWLJazWvfEOoAtpb29HRkYGUlNTbc8pFAqkpqYiPT1dwso8m16vBwAEBQVJXIlneuihh7BgwYIuf6/Jvr755htMmDABt912G8LCwjBu3Dj8+9//lrosjzN58mSkpaXh9OnTAIAjR45g9+7duP766yWuzHOdOXMG5eXlXc4fOp0OycnJ/F7sI5XUBdB51dXVMBqNCA8P7/J8eHg4srOzJarKs5lMJjz66KOYMmUKRo0aJXU5Hufjjz9GZmYmDh48KHUpHq2goABvvvkmVq5cif/5n//BwYMH8bvf/Q5qtRr33HOP1OV5jCeeeAIGgwEJCQlQKpUwGo3461//iiVLlkhdmscqLy8HgEt+L1r/jHqHAZBk7aGHHsLx48exe/duqUvxOEVFRXjkkUewZcsWaLVaqcvxaCaTCRMmTMDf/vY3AMC4ceNw/PhxrF27lgHQjj799FN88MEH+PDDDzFy5EhkZWXh0UcfRVRUFH/P5HY4BOxCQkJCoFQqUVFR0eX5iooKRERESFSV53r44YexadMmbNu2DQMGDJC6HI+TkZGByspKjB8/HiqVCiqVCjt27MCrr74KlUoFo9EodYkeIzIyEiNGjOjy3PDhw1FYWChRRZ7pD3/4A5544gksXrwYo0ePxi9/+Us89thjWLNmjdSleSzrdx+/F+2PAdCFqNVqJCUlIS0tzfacyWRCWloaUlJSJKzMs4iiiIcffhhffvkltm7ditjYWKlL8kizZ8/GsWPHkJWVZXtMmDABS5YsQVZWFpRKpdQleowpU6Zc1Mro9OnTGDhwoEQVeabm5mYoFF2/NpVKJUwmk0QVeb7Y2FhERER0+V40GAzYv38/vxf7iEPALmblypW45557MGHCBEycOBGvvPIKmpqasGzZMqlL8xgPPfQQPvzwQ3z99dfw9/e3zSPR6XTw9vaWuDrP4e/vf9G8Sl9fXwQHB3O+pZ099thjmDx5Mv72t7/h9ttvx4EDB7Bu3TqsW7dO6tI8yo033oi//vWviImJwciRI3H48GG89NJL+NWvfiV1aW6tsbEReXl5tv8+c+YMsrKyEBQUhJiYGDz66KN49tlnER8fj9jYWDz55JOIioqyrRSmXhLJ5bz22mtiTEyMqFarxYkTJ4r79u2TuiSPAuCSj//85z9Sl+bxZsyYIT7yyCNSl+GRNm7cKI4aNUrUaDRiQkKCuG7dOqlL8jgGg0F85JFHxJiYGFGr1YpxcXHi//t//09sa2uTujS3tm3btkuek++55x5RFEXRZDKJTz75pBgeHi5qNBpx9uzZYk5OjrRFewD2ASQiIiKSGc4BJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpIZBkAiIiIimWEAJCIiIpKZ/w+UzPTwq4f9kwAAAABJRU5ErkJggg==", + "text/plain": [ + "" + ] + }, + "metadata": {}, + "output_type": "display_data" + } + ], + "source": [ + "plt.show()" + ] + }, + { + "cell_type": "markdown", + "metadata": { + "tags": [] + }, + "source": [ + "## Matplotlib: support for widgets backend" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "%pip install -q ipympl" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "%matplotlib widget" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "x = np.linspace(0, 10, 1000)\n", + "plt.plot(x, np.sin(x))" + ] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python (Pyodide)", + "language": "python", + "name": "python" + }, + "language_info": { + "codemirror_mode": { + "name": "python", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.8" + }, + "orig_nbformat": 4, + "toc-showcode": false + }, + "nbformat": 4, + "nbformat_minor": 4 +} diff --git a/content/pyodide/plotly.ipynb b/content/pyodide/plotly.ipynb new file mode 100644 index 0000000..9716bee --- /dev/null +++ b/content/pyodide/plotly.ipynb @@ -0,0 +1,158 @@ +{ + "cells": [ + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# Plotly in JupyterLite\n", + "\n", + "`plotly.py` is an interactive, open-source, and browser-based graphing library for Python: https://plotly.com/python/" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "%pip install -q nbformat plotly" + ] + }, + { + "cell_type": "markdown", + "metadata": { + "tags": [] + }, + "source": [ + "## Basic Figure" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "import plotly.graph_objects as go\n", + "fig = go.Figure()\n", + "fig.add_trace(go.Scatter(y=[2, 1, 4, 3]))\n", + "fig.add_trace(go.Bar(y=[1, 4, 3, 2]))\n", + "fig.update_layout(title = 'Hello Figure')\n", + "fig.show()" + ] + }, + { + "cell_type": "markdown", + "metadata": { + "tags": [] + }, + "source": [ + "## Basic Table with a Pandas DataFrame" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "import plotly.graph_objects as go\n", + "import pandas as pd\n", + "\n", + "from js import fetch\n", + "\n", + "URL = \"https://raw.githubusercontent.com/plotly/datasets/master/2014_usa_states.csv\"\n", + "\n", + "res = await fetch(URL)\n", + "text = await res.text()\n", + "\n", + "filename = 'data.csv'\n", + "\n", + "with open(filename, 'w') as f:\n", + " f.write(text)\n", + "\n", + "df = pd.read_csv(filename)\n", + "\n", + "fig = go.Figure(data=[go.Table(\n", + " header=dict(values=list(df.columns),\n", + " fill_color='paleturquoise',\n", + " align='left'),\n", + " cells=dict(values=[df.Rank, df.State, df.Postal, df.Population],\n", + " fill_color='lavender',\n", + " align='left'))\n", + "])\n", + "\n", + "fig.show()" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Quiver Plot with Points" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "import plotly.figure_factory as ff\n", + "import plotly.graph_objects as go\n", + "\n", + "import numpy as np\n", + "\n", + "x,y = np.meshgrid(np.arange(-2, 2, .2),\n", + " np.arange(-2, 2, .25))\n", + "z = x*np.exp(-x**2 - y**2)\n", + "v, u = np.gradient(z, .2, .2)\n", + "\n", + "# Create quiver figure\n", + "fig = ff.create_quiver(x, y, u, v,\n", + " scale=.25,\n", + " arrow_scale=.4,\n", + " name='quiver',\n", + " line_width=1)\n", + "\n", + "# Add points to figure\n", + "fig.add_trace(go.Scatter(x=[-.7, .75], y=[0,0],\n", + " mode='markers',\n", + " marker_size=12,\n", + " name='points'))\n", + "\n", + "fig.show()" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python (Pyodide)", + "language": "python", + "name": "python" + }, + "language_info": { + "codemirror_mode": { + "name": "python", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.8" + }, + "orig_nbformat": 4, + "toc-showcode": false + }, + "nbformat": 4, + "nbformat_minor": 4 +} diff --git a/content/pyodide/pyb2d/0_tutorial.ipynb b/content/pyodide/pyb2d/0_tutorial.ipynb new file mode 100644 index 0000000..3772314 --- /dev/null +++ b/content/pyodide/pyb2d/0_tutorial.ipynb @@ -0,0 +1,649 @@ +{ + "cells": [ + { + "cell_type": "code", + "execution_count": null, + "id": "b07a3b47-2262-4135-a1d2-52e8392b44eb", + "metadata": {}, + "outputs": [], + "source": [ + "import sys\n", + "if \"pyodide\" in sys.modules:\n", + " import piplite\n", + " await piplite.install('pyb2d-jupyterlite-backend>=0.4.2')\n" + ] + }, + { + "cell_type": "markdown", + "id": "49c3f9ea-23ce-4c5c-b3fe-44f1cecadf20", + "metadata": {}, + "source": [ + "pyb2d is imported as b2d" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "dff93359-2c68-467a-9239-478a0e550a4b", + "metadata": {}, + "outputs": [], + "source": [ + "import b2d\n", + "# import pyb2d_jupyterlite_backend\n", + "from pyb2d_jupyterlite_backend.async_jupyter_gui import JupyterAsyncGui\n", + "import numpy as np\n", + "import matplotlib.pylab as plt" + ] + }, + { + "cell_type": "markdown", + "id": "bc977c4e-75ee-4349-9408-650c3dcd01e0", + "metadata": {}, + "source": [ + "# Tutorial 0: A free falling body\n", + "The first step with Box2D is the creation of the world. The world is parametrized by a gravity vector." + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "4ff914a6-eb18-45a1-b1ed-e8ad7ab0d298", + "metadata": {}, + "outputs": [], + "source": [ + "# the world\n", + "gravity = (0, -10)\n", + "world = b2d.World(gravity)" + ] + }, + { + "cell_type": "markdown", + "id": "3afdbb2a-e694-4779-b95e-73a5b38d34b6", + "metadata": {}, + "source": [ + "Create a circle-shaped body" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "99837a63-4628-483c-8f2d-cc4aec9cb1d5", + "metadata": {}, + "outputs": [], + "source": [ + "# the body def\n", + "body_def = b2d.BodyDef()\n", + "body_def.type = b2d.BodyType.dynamic\n", + "body_def.position = (0, 0)\n", + "\n", + "# the body\n", + "body = world.create_body(body_def)\n", + "\n", + "# shape\n", + "circle_shape = b2d.CircleShape()\n", + "circle_shape.radius = 1.0\n", + "\n", + "# the fixture\n", + "fixture_def = b2d.FixtureDef()\n", + "fixture_def.shape = circle_shape\n", + "fixture_def.density = 1.0\n", + "\n", + "# create and add the fixture to the body\n", + "fixture = body.create_fixture(fixture_def)" + ] + }, + { + "cell_type": "markdown", + "id": "bf9758a6-fb6e-4f9c-b15f-783f9488cf7e", + "metadata": {}, + "source": [ + "We can now have a look at the world: We render the world st. each meter in the Box2D world will be 100 pixels in the image:" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "8b433892-3c82-43be-a085-eda3e4279b2c", + "metadata": {}, + "outputs": [], + "source": [ + "# from b2d.plot import render_world\n", + "b2d.plot.plot_world(world, ppm=100)" + ] + }, + { + "cell_type": "markdown", + "id": "5e1db1f1-6e47-454c-9ea9-86262d7da309", + "metadata": {}, + "source": [ + "Lets run the world for a total of 5 seconds. \n", + "Usually one wants to run the world at a certain frame rate.\n", + "With the frame rate and the total time we can compute the delta for each iteration and how many steps we need" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "41a232a9-a3c5-425d-9aed-d3adb90d6314", + "metadata": {}, + "outputs": [], + "source": [ + "t = 5\n", + "fps = 40\n", + "dt = 1.0 / fps\n", + "n_steps = int(t / dt + 0.5)\n", + "print(f\"t={t} fps={fps} dt={dt} n_steps={n_steps}\")" + ] + }, + { + "cell_type": "markdown", + "id": "4d458acb-6d5c-47ba-bcbf-d15ea2cf2537", + "metadata": {}, + "source": [ + "in each step we query the bodies position and velocity and store then for later plotting" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "4e042c7b-07a7-445f-ba04-e38173b46c0f", + "metadata": {}, + "outputs": [], + "source": [ + "positions = np.zeros([n_steps, 2])\n", + "velocites = np.zeros([n_steps, 2])\n", + "timepoints = np.zeros([n_steps])\n", + "\n", + "t_elapsed = 0.0\n", + "for i in range(n_steps):\n", + "\n", + " # get the bodies center of mass\n", + " positions[i, :] = body.world_center\n", + "\n", + " # get the bodies velocity\n", + " velocites[i, :] = body.linear_velocity\n", + "\n", + " timepoints[i] = t_elapsed\n", + "\n", + " world.step(time_step=dt, velocity_iterations=1, position_iterations=1)\n", + " t_elapsed += dt" + ] + }, + { + "cell_type": "markdown", + "id": "0ec7d66c-c979-40fa-8af3-9e99873ec105", + "metadata": {}, + "source": [ + "plot the y-position against the time. We can see that the body is falling down in an accelerating way:" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "434cb907-1b76-414e-bb5e-6ea32dd1f829", + "metadata": {}, + "outputs": [], + "source": [ + "plt.plot(timepoints, positions[:, 1])\n", + "plt.ylabel('y-poistion [meter]')\n", + "plt.xlabel('t [sec]')\n", + "plt.show()" + ] + }, + { + "cell_type": "markdown", + "id": "b7f58954-4ea1-49f9-b0b0-7df38336860d", + "metadata": {}, + "source": [ + "as expected the x position is not changing since the gravity vector is non-zero only in the x direction" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "39573eed-e6c8-45bf-8e35-4251b660ce3f", + "metadata": { + "tags": [] + }, + "outputs": [], + "source": [ + "plt.plot(timepoints, positions[:, 0])\n", + "plt.ylabel('x-poistion [meter]')\n", + "plt.xlabel('t [sec]')\n", + "plt.show()" + ] + }, + { + "cell_type": "markdown", + "id": "cdb98dc5-3bc8-4933-91a0-a1db3afb9c34", + "metadata": {}, + "source": [ + "# Tutorial 1: A falling body in a box, more pythonic\n", + "Create a world, but in a more pythonic way, and animate the world" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "d58c2639-21da-490b-8dcd-205962f63dfc", + "metadata": {}, + "outputs": [], + "source": [ + "# the world\n", + "world = b2d.world(gravity=(0, -10))\n", + "\n", + "# create the dynamic body\n", + "body = world.create_dynamic_body(\n", + " position=(5, 5),\n", + " fixtures=b2d.fixture_def(shape=b2d.circle_shape(radius=1), density=1, restitution=0.75),\n", + ")\n", + "\n", + "# create a box\n", + "box_shape = b2d.ChainShape()\n", + "box_shape.create_loop([(0, 0), (0, 10),(10,10),(10, 0)])\n", + "box = world.create_static_body(\n", + " position=(0, 0), fixtures=b2d.fixture_def(shape=box_shape, friction=0)\n", + ")\n", + "b2d.plot.animate_world(world, ppm=20, t=10)" + ] + }, + { + "cell_type": "markdown", + "id": "10dbb85a-84b0-4820-8fb3-6108d9c0fe00", + "metadata": {}, + "source": [ + "note that when we animate that world again, the body has already been fallen" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "c919702c-7c62-4d87-bf1f-df5027d72a83", + "metadata": {}, + "outputs": [], + "source": [ + "b2d.plot.animate_world(world, ppm=20, t=2)" + ] + }, + { + "cell_type": "markdown", + "id": "7322e9c5-8608-4375-81ed-766cbb2af927", + "metadata": {}, + "source": [ + "# Tutorial 2: Interactive worlds\n", + "While animating the world already is already nice, interacting with the world is even better.\n", + "pyb2d has a framwork to interact with the world for multiple backends.\n", + "This framework is called `TestbedBase` since you can \"test\" your world in an interactive way" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "97cddd47-5a88-4cae-8543-cfcdf658255a", + "metadata": {}, + "outputs": [], + "source": [ + "from b2d.testbed import TestbedBase\n", + "\n", + "class InteractiveExample(TestbedBase):\n", + " def __init__(self, settings=None):\n", + " super(InteractiveExample, self).__init__(settings=settings)\n", + " # create two balls\n", + " body = self.world.create_dynamic_body(position=(5, 5),\n", + " fixtures=b2d.fixture_def(shape=b2d.circle_shape(radius=1), density=1, restitution=0.5),\n", + " )\n", + " body = self.world.create_dynamic_body(position=(8, 5),\n", + " fixtures=b2d.fixture_def(shape=b2d.circle_shape(radius=1), density=1, restitution=0.8),\n", + " )\n", + " # create a box\n", + " box_shape = b2d.ChainShape()\n", + " box_shape.create_loop([(0, 0), (0, 10),(10,10),(10, 0)])\n", + " box = self.world.create_static_body(\n", + " position=(0, 0), fixtures=b2d.fixture_def(shape=box_shape, friction=0)\n", + " )\n", + " \n", + "s = JupyterAsyncGui.Settings()\n", + "s.resolution = [300,300]\n", + "b2d.testbed.run(InteractiveExample, backend=JupyterAsyncGui, gui_settings=s);" + ] + }, + { + "cell_type": "markdown", + "id": "64bf55d1-4117-4af0-8f1f-65de33751743", + "metadata": { + "tags": [] + }, + "source": [ + "# Tutorial 3: Joints" + ] + }, + { + "cell_type": "markdown", + "id": "07147cab-23be-4406-85f7-4b3d174e3954", + "metadata": { + "tags": [] + }, + "source": [ + "## Tutorial 3.1: Prismatic Joint" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "9a2d178d-33d7-4c51-b0ff-f66c98cac673", + "metadata": {}, + "outputs": [], + "source": [ + "world = b2d.world(gravity=(0, -10))\n", + "anchor_body = world.create_static_body(position=(0, 0))\n", + "b = world.create_dynamic_body(\n", + " position=(10, 10),\n", + " fixtures=b2d.fixture_def(shape=b2d.polygon_shape(box=[2, 0.5]), density=1),\n", + " linear_damping=0.0,\n", + " angular_damping=0.0,\n", + ")\n", + "world.create_prismatic_joint(anchor_body, b, local_axis_a=(1, 1))\n", + "b2d.plot.animate_world(world, ppm=20, t=3, bounding_box=((0,0),(10,10)))" + ] + }, + { + "cell_type": "markdown", + "id": "07971d69-b2ef-4d74-8c1c-48f38dcc708c", + "metadata": { + "tags": [] + }, + "source": [ + "## Tutorial 3.2: Pully Joint" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "39b7fef2-4b4b-4904-9899-1a34f1039693", + "metadata": {}, + "outputs": [], + "source": [ + "world = b2d.world(gravity=(0, -10))\n", + "\n", + "\n", + "a = world.create_dynamic_body(\n", + " position=(-5, 0),\n", + " fixtures=b2d.fixture_def(shape=b2d.polygon_shape(box=[2, 0.8]), density=1),\n", + " linear_damping=0.0,\n", + " angular_damping=0.0,\n", + ")\n", + "b = world.create_dynamic_body(\n", + " position=(5, 0),\n", + " fixtures=b2d.fixture_def(shape=b2d.polygon_shape(box=[2, 0.5]), density=1),\n", + " linear_damping=0.0,\n", + " angular_damping=0.0,\n", + ")\n", + "world.create_pully_joint(\n", + " a,\n", + " b,\n", + " length_a=10,\n", + " length_b=10,\n", + " ground_anchor_a=(-5, 10),\n", + " ground_anchor_b=(5, 10),\n", + " local_anchor_a=(0, 0),\n", + " local_anchor_b=(0, 0),\n", + ")\n", + "b2d.plot.animate_world(world, ppm=20, t=5, bounding_box=((-10,-12),(10,12)))" + ] + }, + { + "cell_type": "markdown", + "id": "7e8fb17d-1dda-45cb-98df-6b98be5b4e6c", + "metadata": {}, + "source": [ + "## Tutorial 3.3: Revolute Joint" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "a2686e5f-3fa2-412d-8a40-2e9a67123d43", + "metadata": {}, + "outputs": [], + "source": [ + "world = b2d.world(gravity=(0, -10))\n", + "bodies = []\n", + "b = world.create_static_body(position=(0, 15))\n", + "bodies.append(b)\n", + "for i in range(5):\n", + " b = world.create_dynamic_body(\n", + " position=(i * 4 + 2, 15),\n", + " fixtures=b2d.fixture_def(shape=b2d.polygon_shape(box=[2, 0.5]), density=1),\n", + " linear_damping=0.0,\n", + " angular_damping=0.0,\n", + " )\n", + " bodies.append(b)\n", + "world.create_revolute_joint(\n", + " bodies[0], bodies[1], local_anchor_a=(0, 0), local_anchor_b=(-2, 0.0)\n", + ")\n", + "for i in range(1, len(bodies) - 1):\n", + " a = bodies[i]\n", + " b = bodies[i + 1]\n", + " world.create_revolute_joint(a, b, local_anchor_a=(2, 0.0), local_anchor_b=(-2, 0.0))\n", + "b2d.plot.animate_world(world, ppm=20, t=5, bounding_box=((-20,-10),(20,20)))" + ] + }, + { + "cell_type": "markdown", + "id": "9caa18f0-4eb7-4e72-8445-8f6d096d9465", + "metadata": { + "tags": [] + }, + "source": [ + "## Tutorial 3.4: Weld Joint" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "3d74fb2f-7da5-4ad7-8f21-fba1f97acee2", + "metadata": {}, + "outputs": [], + "source": [ + "# the world\n", + "world = b2d.world(gravity=(0, -10))\n", + "\n", + "\n", + "bodies = []\n", + "\n", + "# create a static body as anchor\n", + "b = world.create_static_body(\n", + " position=(0, 4), fixtures=b2d.fixture_def(shape=b2d.polygon_shape(box=[0.3, 0.5]))\n", + ")\n", + "bodies.append(b)\n", + "\n", + "for i in range(4):\n", + " b = world.create_dynamic_body(\n", + " position=(i + 1.0, 4),\n", + " fixtures=b2d.fixture_def(shape=b2d.polygon_shape(box=[0.3, 0.5]), density=0.1),\n", + " linear_damping=2.5,\n", + " angular_damping=2.5,\n", + " )\n", + " bodies.append(b)\n", + "\n", + "for i in range(len(bodies) - 1):\n", + " a = bodies[i]\n", + " b = bodies[i + 1]\n", + " world.create_weld_joint(\n", + " a,\n", + " b,\n", + " local_anchor_a=(0.5, 0.5),\n", + " local_anchor_b=(-0.5, 0.5),\n", + " damping=0.1,\n", + " reference_angle=0,\n", + " stiffness=20,\n", + " )\n", + " world.create_weld_joint(\n", + " a,\n", + " b,\n", + " local_anchor_a=(0.5, -0.5),\n", + " local_anchor_b=(-0.5, -0.5),\n", + " damping=0.1,\n", + " reference_angle=0,\n", + " stiffness=20,\n", + " )\n", + "b2d.plot.animate_world(world, ppm=20, t=5, bounding_box=((0,-5),(5,5)))" + ] + }, + { + "cell_type": "markdown", + "id": "7373461e-d1fa-4ad9-aeaa-048287839fd9", + "metadata": {}, + "source": [ + "## Tutorial 3.5: Wheel Joint" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "1eb711e0-ae53-43ed-b0c1-c0a2fe42b407", + "metadata": {}, + "outputs": [], + "source": [ + "world = b2d.world(gravity=(0, -10))\n", + "edge = world.create_static_body(\n", + " position=(0, 0), fixtures=b2d.fixture_def(shape=b2d.edge_shape([(-20, 0), (5, 0)]))\n", + ")\n", + "\n", + "# random slope\n", + "x = np.linspace(5, 50, 10)\n", + "y = np.random.rand(10) * 4 - 2\n", + "y[0] = 0\n", + "xy = np.stack([x, y]).T\n", + "xy = np.flip(xy, axis=0)\n", + "edge = world.create_static_body(\n", + " position=(0, 0),\n", + " fixtures=b2d.fixture_def(shape=b2d.chain_shape(xy, prev_vertex=(10, 0))),\n", + ")\n", + "# create car\n", + "left_wheel = world.create_dynamic_body(\n", + " position=(-3, 2),\n", + " fixtures=b2d.fixture_def(shape=b2d.circle_shape(radius=2), density=1),\n", + ")\n", + "right_wheel = world.create_dynamic_body(\n", + " position=(3, 2),\n", + " fixtures=b2d.fixture_def(shape=b2d.circle_shape(radius=2), density=1),\n", + ")\n", + "\n", + "chasis = world.create_dynamic_body(\n", + " position=(0, 2),\n", + " fixtures=b2d.fixture_def(shape=b2d.polygon_shape(box=[3, 0.5]), density=1),\n", + ")\n", + "\n", + "wheel_joint_def = dict(\n", + " stiffness=10,\n", + " enable_motor=True,\n", + " motor_speed=-100,\n", + " max_motor_torque=100,\n", + " collide_connected=False,\n", + " enable_limit=True,\n", + " lower_translation=-0.4,\n", + " upper_translation=0.4,\n", + " local_axis_a=(0, 1),\n", + ")\n", + "world.create_wheel_joint(chasis, left_wheel, local_anchor_a=(-3, 0), **wheel_joint_def)\n", + "world.create_wheel_joint(chasis, right_wheel, local_anchor_a=(3, 0), **wheel_joint_def)\n", + "\n", + "\n", + "b2d.plot.animate_world(world, ppm=20, t=15, bounding_box=((-10,-5),(20,5)))" + ] + }, + { + "cell_type": "markdown", + "id": "d9a0fffc-ae40-47ec-b185-2a6fe0dde496", + "metadata": {}, + "source": [ + "## Tutorial 3.6: Distance Joint" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "3c121398-f08f-4ea0-a875-de141ba53508", + "metadata": {}, + "outputs": [], + "source": [ + "world = b2d.world(gravity=(0, -10))\n", + "\n", + "for i in range(10):\n", + "\n", + " # create static anchor (does not need shape/fixture)\n", + " anchor = world.create_static_body(position=(i, 0))\n", + "\n", + " # 5 below the anchor\n", + " body = world.create_dynamic_body(\n", + " position=(i, -10),\n", + " fixtures=b2d.fixture_def(shape=b2d.circle_shape(radius=0.4), density=0.5),\n", + " )\n", + "\n", + " # distance joints of various stiffness-es\n", + " world.create_distance_joint(anchor, body, length=10, stiffness=0.5 * (i + 1))\n", + "\n", + "b2d.plot.animate_world(world, ppm=20, t=10, bounding_box=((-2,-20),(10,0)))" + ] + }, + { + "cell_type": "markdown", + "id": "fb6afaff-8236-4206-85c7-3ba2de466ba9", + "metadata": {}, + "source": [ + "# Tutorial 4: Particles" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "8f5c3b83-51d9-47cb-9b73-d5f8b0e03a76", + "metadata": {}, + "outputs": [], + "source": [ + "world = b2d.world(gravity=(0, -10))\n", + "pdef = b2d.particle_system_def(radius=0.1)\n", + "psystem = world.create_particle_system(pdef)\n", + "\n", + "emitter_pos = (0, 0)\n", + "emitter_def = b2d.RandomizedLinearEmitterDef()\n", + "emitter_def.emite_rate = 400\n", + "emitter_def.lifetime = 5.1\n", + "emitter_def.size = (2, 1)\n", + "emitter_def.velocity = (6, 20)\n", + "emitter = b2d.RandomizedLinearEmitter(psystem, emitter_def)\n", + "b2d.plot.animate_world(world, ppm=20, t=10, bounding_box=((-10,-20),(20,5)), pre_step=emitter.step)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "ea9d7882-d3a4-45bb-b59b-cb1c9cd33990", + "metadata": {}, + "outputs": [], + "source": [] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python 3 (ipykernel)", + "language": "python", + "name": "python3" + }, + "language_info": { + "codemirror_mode": { + "name": "ipython", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.10.4" + } + }, + "nbformat": 4, + "nbformat_minor": 5 +} diff --git a/content/pyodide/pyb2d/color_mixing.ipynb b/content/pyodide/pyb2d/color_mixing.ipynb new file mode 100644 index 0000000..9dc274c --- /dev/null +++ b/content/pyodide/pyb2d/color_mixing.ipynb @@ -0,0 +1,123 @@ +{ + "cells": [ + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "import sys\n", + "if \"pyodide\" in sys.modules:\n", + " import piplite\n", + " await piplite.install('pyb2d-jupyterlite-backend>=0.4.2')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "from b2d.testbed import TestbedBase\n", + "import random\n", + "import numpy\n", + "import b2d\n", + "\n", + "class ColorMixing(TestbedBase):\n", + "\n", + " name = \"ColorMixing\"\n", + "\n", + " def __init__(self, settings=None):\n", + " super(ColorMixing, self).__init__(settings=settings)\n", + " dimensions = [30, 30]\n", + "\n", + " # the outer box\n", + " box_shape = b2d.ChainShape()\n", + " box_shape.create_loop(\n", + " [\n", + " (0, 0),\n", + " (0, dimensions[1]),\n", + " (dimensions[0], dimensions[1]),\n", + " (dimensions[0], 0),\n", + " ]\n", + " )\n", + " box = self.world.create_static_body(position=(0, 0), shape=box_shape)\n", + "\n", + " fixtureA = b2d.fixture_def(\n", + " shape=b2d.circle_shape(1), density=2.2, friction=0.2, restitution=0.5\n", + " )\n", + " body = self.world.create_dynamic_body(position=(13, 10), fixtures=fixtureA)\n", + "\n", + " pdef = b2d.particle_system_def(\n", + " viscous_strength=0.9,\n", + " spring_strength=0.0,\n", + " damping_strength=0.5,\n", + " pressure_strength=0.5,\n", + " color_mixing_strength=0.008,\n", + " density=2,\n", + " )\n", + " psystem = self.world.create_particle_system(pdef)\n", + " psystem.radius = 0.3\n", + " psystem.damping = 1.0\n", + "\n", + " colors = [\n", + " (255, 0, 0, 255),\n", + " (0, 255, 0, 255),\n", + " (0, 0, 255, 255),\n", + " (255, 255, 0, 255),\n", + " ]\n", + " posiitons = [(6, 10), (20, 10), (20, 20), (6, 20)]\n", + " for color, pos in zip(colors, posiitons):\n", + "\n", + " shape = b2d.polygon_shape(box=(5, 5), center=pos, angle=0)\n", + " pgDef = b2d.particle_group_def(\n", + " flags=b2d.ParticleFlag.waterParticle\n", + " | b2d.ParticleFlag.colorMixingParticle,\n", + " # group_flags=b2d.ParticleGroupFlag.solidParticleGroup,\n", + " shape=shape,\n", + " strength=1.0,\n", + " color=color,\n", + " )\n", + " group = psystem.create_particle_group(pgDef)\n", + "\n" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "from pyb2d_jupyterlite_backend.async_jupyter_gui import JupyterAsyncGui\n", + "\n", + "s = JupyterAsyncGui.Settings()\n", + "s.resolution = [1000,500]\n", + "s.scale = 8\n", + "s.fps = 40\n", + "\n", + "tb = b2d.testbed.run(ColorMixing, backend=JupyterAsyncGui, gui_settings=s)" + ] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python 3 (ipykernel)", + "language": "python", + "name": "python3" + }, + "language_info": { + "codemirror_mode": { + "name": "ipython", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.10.4" + } + }, + "nbformat": 4, + "nbformat_minor": 4 +} diff --git a/content/pyodide/pyb2d/games/angry_shapes.ipynb b/content/pyodide/pyb2d/games/angry_shapes.ipynb new file mode 100644 index 0000000..cb199ef --- /dev/null +++ b/content/pyodide/pyb2d/games/angry_shapes.ipynb @@ -0,0 +1,419 @@ +{ + "cells": [ + { + "cell_type": "code", + "execution_count": null, + "id": "2859de40-f927-4790-b192-c5b0531058f7", + "metadata": {}, + "outputs": [], + "source": [ + "import sys\n", + "if \"pyodide\" in sys.modules:\n", + " import piplite\n", + " await piplite.install('pyb2d-jupyterlite-backend>=0.4.2')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "8ac3e93b-3e9e-4cd7-a183-0214b0dcb513", + "metadata": {}, + "outputs": [], + "source": [ + "from b2d.testbed import TestbedBase\n", + "import math\n", + "import numpy\n", + "import b2d\n", + "\n", + "class AngryShapes(TestbedBase):\n", + "\n", + " name = \"AngryShapes\"\n", + "\n", + " class Settings(TestbedBase.Settings):\n", + " substeps: int = 2\n", + "\n", + " def draw_segment(self, p1, p2, color, line_width=1):\n", + " screen_p1 = self._point(self.world_to_screen(p1))\n", + " screen_p2 = self._point(self.world_to_screen(p2))\n", + " screen_color = self._uint8_color(color)\n", + " screen_line_width = self._line_width(line_width)\n", + "\n", + " cv.line(self._image, screen_p1, screen_p2, screen_color, screen_line_width)\n", + "\n", + " def draw_polygon(self, vertices, color, line_width=1):\n", + " # todo add C++ function for this\n", + " screen_vertices = numpy.array(\n", + " [self._point(self.world_to_screen(v)) for v in vertices], dtype=\"int32\"\n", + " )\n", + " screen_color = self._uint8_color(color)\n", + " screen_line_width = self._line_width(line_width)\n", + "\n", + " cv.polylines(\n", + " self._image, [screen_vertices], True, screen_color, screen_line_width, 8\n", + " )\n", + "\n", + " def draw_solid_polygon(self, vertices, color):\n", + " # todo add C++ function for this\n", + " screen_vertices = numpy.array(\n", + " [self._point(self.world_to_screen(v)) for v in vertices], dtype=\"int32\"\n", + " )\n", + " screen_color = self._uint8_color(color)\n", + "\n", + " cv.fillPoly(self._image, [screen_vertices], screen_color, 8)\n", + "\n", + " def __init__(self, settings=None):\n", + " super(AngryShapes, self).__init__(settings=settings)\n", + "\n", + " self.targets = []\n", + " self.projectiles = []\n", + " self.marked_for_destruction = []\n", + " self.emitter = None\n", + "\n", + " # particle system\n", + " pdef = b2d.particle_system_def(\n", + " viscous_strength=0.9,\n", + " spring_strength=0.0,\n", + " damping_strength=100.5,\n", + " pressure_strength=1.0,\n", + " color_mixing_strength=0.05,\n", + " density=0.1,\n", + " )\n", + "\n", + " self.psystem = self.world.create_particle_system(pdef)\n", + " self.psystem.radius = 1\n", + " self.psystem.damping = 0.5\n", + "\n", + " self.build_outer_box()\n", + " self.build_castle()\n", + " self.build_launcher()\n", + " self.arm_launcher()\n", + " self.build_explosives()\n", + "\n", + " def build_outer_box(self):\n", + " # the outer box\n", + "\n", + " shape = b2d.edge_shape([(100, 0), (600, 0)])\n", + " box = self.world.create_static_body(\n", + " position=(0, 0), fixtures=b2d.fixture_def(shape=shape, friction=1)\n", + " )\n", + "\n", + " def build_target(self, pos):\n", + " t = self.world.create_dynamic_body(\n", + " position=pos,\n", + " fixtures=[\n", + " b2d.fixture_def(shape=b2d.circle_shape(radius=4), density=1.0),\n", + " b2d.fixture_def(\n", + " shape=b2d.circle_shape(radius=2, pos=(3, 3)), density=1.0\n", + " ),\n", + " b2d.fixture_def(\n", + " shape=b2d.circle_shape(radius=2, pos=(-3, 3)), density=1.0\n", + " ),\n", + " ],\n", + " linear_damping=0,\n", + " angular_damping=0,\n", + " user_data=\"target\",\n", + " )\n", + " self.targets.append(t)\n", + "\n", + " def build_castle(self):\n", + " def build_pyramid(offset, bar_shape, n):\n", + " def build_brick(pos, size):\n", + " hsize = [s / 2 for s in size]\n", + " self.world.create_dynamic_body(\n", + " position=(\n", + " pos[0] + hsize[0] + offset[0],\n", + " pos[1] + hsize[1] + offset[1],\n", + " ),\n", + " fixtures=b2d.fixture_def(\n", + " shape=b2d.polygon_shape(box=hsize), density=8\n", + " ),\n", + " user_data=\"brick\",\n", + " )\n", + "\n", + " bar_length = bar_shape[0]\n", + " bar_width = bar_shape[1]\n", + "\n", + " nxm = n\n", + " for y in range(nxm):\n", + " py = y * (bar_length + bar_width)\n", + " nx = nxm - y\n", + " for x in range(nx):\n", + " px = x * bar_length + y * (bar_length) / 2.0\n", + " if y + 1 < nxm - 1:\n", + " if x == 0:\n", + " px += bar_width / 2\n", + " if x + 1 == nx:\n", + " px -= bar_width / 2\n", + "\n", + " build_brick((px, py), (bar_width, bar_length))\n", + " if x < nx - 1:\n", + " self.build_target(\n", + " pos=(\n", + " px + offset[0] + bar_length / 2,\n", + " py + offset[1] + bar_width,\n", + " )\n", + " )\n", + " build_brick(\n", + " (px + bar_width / 2, py + bar_length),\n", + " (bar_length, bar_width),\n", + " )\n", + "\n", + " build_pyramid(offset=(100, 0), bar_shape=[40, 4], n=4)\n", + " build_pyramid(offset=(400, 0), bar_shape=[30, 3], n=4)\n", + "\n", + " def build_launcher(self):\n", + "\n", + " self.launcher_anchor_pos = (30, 0)\n", + " self.launcher_anchor = self.world.create_static_body(\n", + " position=self.launcher_anchor_pos\n", + " )\n", + "\n", + " def arm_launcher(self):\n", + " self.reload_time = None\n", + " self.is_armed = True\n", + " self.projectile_radius = 3\n", + " projectile_pos = (self.launcher_anchor_pos[0], self.launcher_anchor_pos[1] / 2)\n", + "\n", + " self.projectile = self.world.create_dynamic_body(\n", + " position=projectile_pos,\n", + " fixtures=b2d.fixture_def(\n", + " shape=b2d.circle_shape(radius=self.projectile_radius), density=100.0\n", + " ),\n", + " linear_damping=0,\n", + " angular_damping=0,\n", + " user_data=\"projectile\",\n", + " )\n", + " self.projectiles.append(self.projectile)\n", + " self.projectile_joint = self.world.create_distance_joint(\n", + " self.launcher_anchor, self.projectile, length=1, stiffness=10000\n", + " )\n", + " self.mouse_joint = None\n", + "\n", + " def build_explosives(self):\n", + " self.explosives = []\n", + "\n", + " def on_mouse_down(self, p):\n", + " if self.is_armed:\n", + " body = self.world.find_body(pos=p)\n", + " if body is not None and body.user_data is not None:\n", + " print(\"got body\")\n", + " if body.user_data == \"projectile\":\n", + " print(\"got projectile\")\n", + " kwargs = dict(\n", + " body_a=self.groundbody,\n", + " body_b=body,\n", + " target=p,\n", + " max_force=50000.0 * body.mass,\n", + " stiffness=10000.0,\n", + " )\n", + "\n", + " self.mouse_joint = self.world.create_mouse_joint(**kwargs)\n", + " body.awake = True\n", + " return True\n", + "\n", + " return False\n", + "\n", + " def on_mouse_move(self, p):\n", + " if self.is_armed:\n", + " if self.mouse_joint is not None:\n", + " self.mouse_joint.target = p\n", + " return True\n", + " return False\n", + "\n", + " def on_mouse_up(self, p):\n", + " if self.is_armed:\n", + " if self.mouse_joint is not None:\n", + " self.world.destroy_joint(self.mouse_joint)\n", + " if self.projectile_joint is not None:\n", + " self.world.destroy_joint(self.projectile_joint)\n", + " self.projectile_joint = None\n", + " self.mouse_joint = None\n", + " delta = self.launcher_anchor.position - b2d.vec2(p)\n", + " scaled_delta = delta * 50000.0\n", + " print(scaled_delta)\n", + "\n", + " self.projectile.apply_linear_impulse_to_center(scaled_delta, True)\n", + " self.reload_time = self.elapsed_time + 1.0\n", + " self.is_armed = False\n", + " return False\n", + "\n", + " def begin_contact(self, contact):\n", + " body_a = contact.body_a\n", + " body_b = contact.body_b\n", + " ud_a = body_a.user_data\n", + " ud_b = body_b.user_data\n", + " if ud_b == \"projectile\":\n", + " body_a, body_b = body_b, body_a\n", + " ud_a, ud_b = ud_b, ud_a\n", + " if ud_a == \"projectile\":\n", + "\n", + " if ud_b == \"target\" or ud_b == \"brick\":\n", + " self.marked_for_destruction.append(body_a)\n", + " emitter_def = b2d.RandomizedRadialEmitterDef()\n", + " emitter_def.emite_rate = 20000\n", + " emitter_def.lifetime = 0.7\n", + " emitter_def.enabled = True\n", + " emitter_def.inner_radius = 0.0\n", + " emitter_def.outer_radius = 1.0\n", + " emitter_def.velocity_magnitude = 1000.0\n", + " emitter_def.start_angle = 0\n", + " emitter_def.stop_angle = math.pi\n", + " emitter_def.transform = b2d.Transform(body_a.position, b2d.Rot(0))\n", + " self.emitter = b2d.RandomizedRadialEmitter(self.psystem, emitter_def)\n", + " self.emitter_die_time = self.elapsed_time + 0.02\n", + "\n", + " def pre_step(self, dt):\n", + "\n", + " if self.reload_time is not None:\n", + " if self.elapsed_time >= self.reload_time:\n", + " self.arm_launcher()\n", + "\n", + " # delete contact bodies\n", + " for body in self.marked_for_destruction:\n", + " if body in self.projectiles:\n", + " self.projectiles.remove(body)\n", + " self.world.destroy_body(body)\n", + " if body == self.projectile:\n", + " self.reload_time = self.elapsed_time + 1.0\n", + " self.marked_for_destruction = []\n", + "\n", + " # delete bodies which have fallen down\n", + " for body in self.world.bodies:\n", + " if body.position.y < -100:\n", + " if body.user_data == \"projectile\":\n", + " self.projectiles.remove(body)\n", + " if body.user_data == \"target\":\n", + " self.targets.remove(body)\n", + " self.world.destroy_body(body)\n", + "\n", + " # emmiter\n", + " if self.emitter is not None:\n", + " self.emitter.step(dt)\n", + " if self.elapsed_time >= self.emitter_die_time:\n", + " self.emitter = None\n", + "\n", + " def draw_target(self, target):\n", + " center = target.position\n", + " center_l = target.get_world_point((-3, 3))\n", + " center_r = target.get_world_point((3, 3))\n", + " eye_left = target.get_world_point((-1, 1))\n", + " eye_right = target.get_world_point((1, 1))\n", + " pink = [c / 255 for c in (248, 24, 148)]\n", + "\n", + " self.debug_draw.draw_solid_circle(\n", + " center=center, radius=4, axis=None, color=pink\n", + " )\n", + " self.debug_draw.draw_solid_circle(\n", + " center=center_l, radius=2, axis=None, color=pink\n", + " )\n", + " self.debug_draw.draw_solid_circle(\n", + " center=center_r, radius=2, axis=None, color=pink\n", + " )\n", + "\n", + " # schnautze\n", + " nose_center = target.get_world_point((0, -1))\n", + " nose_center_l = target.get_world_point((-0.3, -1))\n", + " nose_center_r = target.get_world_point((0.3, -1))\n", + "\n", + " self.debug_draw.draw_circle(\n", + " center=nose_center,\n", + " radius=2,\n", + " # axis=None,\n", + " color=(1, 1, 1),\n", + " line_width=0.2,\n", + " )\n", + " # eyes\n", + " for nose_center in [nose_center_l, nose_center_r]:\n", + " self.debug_draw.draw_solid_circle(\n", + " center=nose_center, radius=0.6, axis=None, color=(1, 1, 1)\n", + " )\n", + " # eyes\n", + " for eye_center in [eye_left, eye_right]:\n", + " self.debug_draw.draw_solid_circle(\n", + " center=eye_center, radius=1, axis=None, color=(1, 1, 1)\n", + " )\n", + " self.debug_draw.draw_solid_circle(\n", + " center=eye_center, radius=0.7, axis=None, color=(0, 0, 0)\n", + " )\n", + "\n", + " def draw_projectile(self, projectile):\n", + "\n", + " center = projectile.position\n", + " # center_l = target.get_world_point((-3,3))\n", + " # center_r = target.get_world_point(( 3,3))\n", + " eye_left = projectile.get_world_point((-1, 1))\n", + " eye_right = projectile.get_world_point((1, 1))\n", + "\n", + " self.debug_draw.draw_solid_circle(\n", + " center=center,\n", + " radius=self.projectile_radius * 1.1,\n", + " axis=None,\n", + " color=(1, 0, 0),\n", + " )\n", + "\n", + " # eyes\n", + " for eye_center in [eye_left, eye_right]:\n", + " self.debug_draw.draw_solid_circle(\n", + " center=eye_center, radius=1, axis=None, color=(1, 1, 1)\n", + " )\n", + " self.debug_draw.draw_solid_circle(\n", + " center=eye_center, radius=0.7, axis=None, color=(0, 0, 0)\n", + " )\n", + "\n", + " def post_debug_draw(self):\n", + " for target in self.targets:\n", + " self.draw_target(target)\n", + "\n", + " for projectile in self.projectiles:\n", + " self.draw_projectile(projectile)" + ] + }, + { + "cell_type": "markdown", + "id": "6df7c8b9-216b-4fd2-8ee8-aeec294e149d", + "metadata": {}, + "source": [ + "# Controlls\n", + "* To play this game, click and drag the red ball and release it to shot it.\n", + "* Use the mouse-wheel to zoom in/out, a\n", + "* Click and drag in the empty space to translate the view." + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "df412e76-7a9a-4e1d-8bc7-c02e222e10dc", + "metadata": {}, + "outputs": [], + "source": [ + "from pyb2d_jupyterlite_backend.async_jupyter_gui import JupyterAsyncGui\n", + "s = JupyterAsyncGui.Settings()\n", + "s.resolution = [1000,500]\n", + "s.scale = 2\n", + "s.translate = [100,100]\n", + "tb = b2d.testbed.run(AngryShapes, backend=JupyterAsyncGui, gui_settings=s);" + ] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python 3 (ipykernel)", + "language": "python", + "name": "python3" + }, + "language_info": { + "codemirror_mode": { + "name": "ipython", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.10.4" + } + }, + "nbformat": 4, + "nbformat_minor": 5 +} diff --git a/content/pyodide/pyb2d/games/billiard.ipynb b/content/pyodide/pyb2d/games/billiard.ipynb new file mode 100644 index 0000000..13fff3a --- /dev/null +++ b/content/pyodide/pyb2d/games/billiard.ipynb @@ -0,0 +1,299 @@ +{ + "cells": [ + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "import sys\n", + "if \"pyodide\" in sys.modules:\n", + " import piplite\n", + " await piplite.install('pyb2d-jupyterlite-backend>=0.4.2')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "import numpy\n", + "import b2d\n", + "import math\n", + "import random\n", + "\n", + "from b2d.testbed import TestbedBase\n", + "\n", + "class Billiard(TestbedBase):\n", + "\n", + " name = \"Billiard\"\n", + "\n", + " def __init__(self, settings=None):\n", + " super(Billiard, self).__init__(gravity=(0, 0), settings=settings)\n", + " dimensions = [30, 50]\n", + " self.dimensions = dimensions\n", + "\n", + " # the outer box\n", + " box_shape = b2d.ChainShape()\n", + " box_shape.create_loop(\n", + " [\n", + " (0, 0),\n", + " (0, dimensions[1]),\n", + " (dimensions[0], dimensions[1]),\n", + " (dimensions[0], 0),\n", + " ]\n", + " )\n", + " self.ball_radius = 1\n", + " box = self.world.create_static_body(\n", + " position=(0, 0), fixtures=b2d.fixture_def(shape=box_shape, friction=0)\n", + " )\n", + "\n", + " self.place_balls()\n", + " self.place_pockets()\n", + "\n", + " # mouse interaction\n", + " self._selected_ball = None\n", + " self._selected_ball_pos = None\n", + " self._last_pos = None\n", + "\n", + " # balls to be destroyed in the next step\n", + " # since they are in the pocket\n", + " self._to_be_destroyed = []\n", + "\n", + " def place_pockets(self):\n", + " pocket_radius = 1\n", + " self.pockets = []\n", + "\n", + " def place_pocket(position):\n", + " pocket_shape = b2d.circle_shape(radius=pocket_radius / 3)\n", + " pocket = self.world.create_static_body(\n", + " position=position,\n", + " fixtures=b2d.fixture_def(shape=pocket_shape, is_sensor=True),\n", + " user_data=(\"pocket\", None),\n", + " )\n", + " self.pockets.append(pocket)\n", + "\n", + " d = pocket_radius / 2\n", + "\n", + " place_pocket(position=(0 + d, 0 + d))\n", + " place_pocket(position=(self.dimensions[0] - d, 0 + d))\n", + "\n", + " place_pocket(position=(0 + d, self.dimensions[1] / 2))\n", + " place_pocket(position=(self.dimensions[0] - d, self.dimensions[1] / 2))\n", + "\n", + " place_pocket(position=(0 + d, self.dimensions[1] - d))\n", + " place_pocket(position=(self.dimensions[0] - d, self.dimensions[1] - d))\n", + "\n", + " def place_balls(self):\n", + " self.balls = []\n", + "\n", + " base_colors = [\n", + " (1, 1, 0),\n", + " (0, 0, 1),\n", + " (1, 0, 0),\n", + " (1, 0, 1),\n", + " (1, 0.6, 0),\n", + " (0, 1, 0),\n", + " (0.7, 0.4, 0.4),\n", + " ]\n", + " colors = []\n", + " for color in base_colors:\n", + " # ``full`` ball\n", + " colors.append((color, color))\n", + " # ``half`` ball (half white)\n", + " colors.append((color, (1, 1, 1)))\n", + "\n", + " random.shuffle(colors)\n", + " colors.insert(4, ((0, 0, 0), (0, 0, 0))) # black\n", + "\n", + " n_y = 5\n", + " c_x = self.dimensions[0] / 2\n", + " diameter = (self.ball_radius * 2) * 1.01\n", + "\n", + " bi = 0\n", + " for y in range(n_y):\n", + "\n", + " py = y * diameter * 0.5 * math.sqrt(3)\n", + " n_x = y + 1\n", + " ox = diameter * (n_y - y) / 2\n", + " for x in range(y + 1):\n", + " position = (x * diameter + 10 + ox, py + 30)\n", + " self.create_billard_ball(position=position, color=colors[bi])\n", + " bi += 1\n", + "\n", + " self.create_billard_ball(position=(c_x, 10), color=((1, 1, 1), (1, 1, 1)))\n", + "\n", + " def create_billard_ball(self, position, color):\n", + "\n", + " ball = self.world.create_dynamic_body(\n", + " position=position,\n", + " fixtures=b2d.fixture_def(\n", + " shape=b2d.circle_shape(radius=self.ball_radius),\n", + " density=1.0,\n", + " restitution=0.8,\n", + " ),\n", + " linear_damping=0.8,\n", + " user_data=(\"ball\", color),\n", + " fixed_rotation=True,\n", + " )\n", + " self.balls.append(ball)\n", + "\n", + " def begin_contact(self, contact):\n", + " body_a = contact.body_a\n", + " body_b = contact.body_b\n", + "\n", + " ud_a = body_a.user_data\n", + " ud_b = body_b.user_data\n", + " if ud_a is None or ud_b is None:\n", + " return\n", + "\n", + " if ud_b[0] == \"ball\":\n", + " body_a, body_b = body_b, body_a\n", + " ud_a, ud_b = ud_b, ud_a\n", + "\n", + " if ud_a[0] == \"ball\" and ud_b[0] == \"pocket\":\n", + " self._to_be_destroyed.append(body_a)\n", + "\n", + " def pre_step(self, dt):\n", + " for b in self._to_be_destroyed:\n", + " self.balls.remove(b)\n", + " self.world.destroy_body(b)\n", + " self._to_be_destroyed = []\n", + "\n", + " def ball_at_position(self, pos):\n", + " body = self.world.find_body(pos)\n", + " if body is not None:\n", + " user_data = body.user_data\n", + " if user_data is not None and user_data[0] == \"ball\":\n", + " return body\n", + " return None\n", + "\n", + " def on_mouse_down(self, pos):\n", + " body = self.ball_at_position(pos)\n", + " if body is not None:\n", + " self._selected_ball = body\n", + " self._selected_ball_pos = pos\n", + " return True\n", + "\n", + " return False\n", + "\n", + " def on_mouse_move(self, pos):\n", + " if self._selected_ball is not None:\n", + " self._last_pos = pos\n", + " return True\n", + " return False\n", + "\n", + " def on_mouse_up(self, pos):\n", + " if self._selected_ball is not None:\n", + " self._last_pos = pos\n", + " # if the mouse is in the starting ball itself we do nothing\n", + " if self.ball_at_position(pos) != self._selected_ball:\n", + " delta = b2d.vec2(self._selected_ball_pos) - b2d.vec2(self._last_pos)\n", + " delta *= 100.0\n", + " self._selected_ball.apply_linear_impulse(\n", + " delta, self._selected_ball_pos, True\n", + " )\n", + " self._selected_ball = None\n", + " self._selected_ball_pos = None\n", + " self._last_pos = None\n", + " return False\n", + "\n", + " def post_debug_draw(self):\n", + "\n", + " for pocket in self.pockets:\n", + " self.debug_draw.draw_solid_circle(\n", + " pocket.position, self.ball_radius, (1, 0), (1, 1, 1)\n", + " )\n", + "\n", + " for ball in self.balls:\n", + " _, (color0, color1) = ball.user_data\n", + "\n", + " self.debug_draw.draw_solid_circle(\n", + " ball.position, self.ball_radius, (1, 0), color0\n", + " )\n", + " self.debug_draw.draw_solid_circle(\n", + " ball.position, self.ball_radius / 2, (1, 0), color1\n", + " )\n", + " self.debug_draw.draw_circle(\n", + " ball.position, self.ball_radius, (1, 1, 1), line_width=0.1\n", + " )\n", + "\n", + " if self._selected_ball is not None:\n", + "\n", + " # draw circle around selected ball\n", + " self.debug_draw.draw_circle(\n", + " self._selected_ball.position,\n", + " self.ball_radius * 2,\n", + " (1, 1, 1),\n", + " line_width=0.2,\n", + " )\n", + "\n", + " # mark position on selected ball with red dot\n", + " self.debug_draw.draw_solid_circle(\n", + " self._selected_ball_pos, self.ball_radius * 0.2, (1, 0), (1, 0, 0)\n", + " )\n", + "\n", + " # draw the line between marked pos on ball and last pos\n", + " if self._last_pos is not None:\n", + " self.debug_draw.draw_segment(\n", + " self._selected_ball_pos, self._last_pos, (1, 1, 1), line_width=0.2\n", + " )" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# Controlls\n", + "* To play this game, click and hold inside a billiard ball, move and release the mouse to shoot the ball.\n", + "* Use the mouse-wheel to zoom in/out, a\n", + "* Click and drag in the empty space to translate the view." + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "from pyb2d_jupyterlite_backend.async_jupyter_gui import JupyterAsyncGui\n", + "backend = JupyterAsyncGui\n", + "s = backend.Settings()\n", + "s.resolution = [500,600]\n", + "s.scale = 8\n", + "s.fps = 40\n", + "s.translate = [125,100]\n", + "b2d.testbed.run(Billiard, backend=backend, gui_settings=s);" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python 3 (ipykernel)", + "language": "python", + "name": "python3" + }, + "language_info": { + "codemirror_mode": { + "name": "ipython", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.10.4" + } + }, + "nbformat": 4, + "nbformat_minor": 4 +} diff --git a/content/pyodide/pyb2d/games/goo.ipynb b/content/pyodide/pyb2d/games/goo.ipynb new file mode 100644 index 0000000..cbe018c --- /dev/null +++ b/content/pyodide/pyb2d/games/goo.ipynb @@ -0,0 +1,575 @@ +{ + "cells": [ + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "import sys\n", + "if \"pyodide\" in sys.modules:\n", + " import piplite\n", + " await piplite.install('networkx')\n", + " await piplite.install('pyb2d-jupyterlite-backend>=0.4.2')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "import b2d\n", + "from b2d.testbed import TestbedBase\n", + "import math\n", + "import random\n", + "import numpy\n", + "from functools import partial\n", + "import networkx\n", + "from pyb2d_jupyterlite_backend.async_jupyter_gui import JupyterAsyncGui\n", + "\n", + "def best_pairwise_distance(data, f, distance):\n", + " n = len(data)\n", + " best = (None, None, float(\"inf\"))\n", + " for i in range(n - 1):\n", + " da = f(data[i])\n", + " for j in range(i + 1, n):\n", + " db = f(data[j])\n", + "\n", + " d = distance(da, db)\n", + " if d < best[2]:\n", + " best = (i, j, d)\n", + " return best\n", + "\n", + "class Level(object):\n", + " def __init__(self, testbed):\n", + " self.testbed = testbed\n", + " self.world = testbed.world\n", + "\n", + " self.gap_size = 15\n", + " self.kill_sensors_height = 0.5\n", + " self.usable_size = 20\n", + " self.h = 10\n", + " self.end_zone_height = 3\n", + "\n", + " self.outline_verts = [\n", + " (0, self.h),\n", + " (0, 2 * self.h),\n", + " (0, self.h),\n", + " (self.usable_size, self.h),\n", + " (self.usable_size, 0),\n", + " (self.usable_size + self.gap_size, 0),\n", + " (self.usable_size + self.gap_size, self.h),\n", + " (2 * self.usable_size + self.gap_size, self.h),\n", + " (2 * self.usable_size + self.gap_size, 2 * self.h),\n", + " ]\n", + "\n", + " # outline of the level\n", + " shape = b2d.chain_shape(vertices=numpy.flip(self.outline_verts, axis=0))\n", + " self.outline = self.world.create_static_body(position=(0, 0), shape=shape)\n", + "\n", + " # kill sensors\n", + " self.kill_sensor_pos = (\n", + " self.usable_size + self.gap_size / 2,\n", + " self.kill_sensors_height / 2,\n", + " )\n", + "\n", + " shape = b2d.polygon_shape(box=(self.gap_size / 2, self.kill_sensors_height / 2))\n", + " self._kill_sensor = self.world.create_static_body(\n", + " position=self.kill_sensor_pos,\n", + " fixtures=b2d.fixture_def(shape=shape, is_sensor=True),\n", + " )\n", + " self._kill_sensor.user_data = \"destroyer\"\n", + "\n", + " # end sensor\n", + " shape = b2d.polygon_shape(box=(self.usable_size / 2, self.end_zone_height / 2))\n", + " self._end_sensor = self.world.create_static_body(\n", + " position=(\n", + " 1.5 * self.usable_size + self.gap_size,\n", + " self.h + self.end_zone_height / 2,\n", + " ),\n", + " fixtures=b2d.fixture_def(shape=shape, is_sensor=True),\n", + " )\n", + " self._end_sensor.user_data = \"goal\"\n", + "\n", + " goo_radius = 1\n", + " a = self.testbed.insert_goo(\n", + " pos=(self.usable_size / 3, self.h + goo_radius), static=True\n", + " )\n", + " b = self.testbed.insert_goo(\n", + " pos=(self.usable_size * 2 / 3, self.h + goo_radius), static=True\n", + " )\n", + " c = self.testbed.insert_goo(\n", + " pos=(self.usable_size * 1 / 2, self.h + goo_radius + 4), static=False\n", + " )\n", + "\n", + " self.testbed.connect_goos(a, b)\n", + " self.testbed.connect_goos(a, c)\n", + " self.testbed.connect_goos(b, c)\n", + "\n", + " def draw(self, debug_draw):\n", + "\n", + " # draw outline\n", + " for i in range(len(self.outline_verts) - 1):\n", + " debug_draw.draw_segment(\n", + " self.outline_verts[i],\n", + " self.outline_verts[i + 1],\n", + " color=(1, 1, 0),\n", + " line_width=0.3,\n", + " )\n", + "\n", + " left = list(self.kill_sensor_pos)\n", + " left[0] -= self.gap_size / 2\n", + " left[1] += self.kill_sensors_height / 2\n", + "\n", + " right = list(self.kill_sensor_pos)\n", + " right[0] += self.gap_size / 2\n", + " right[1] += self.kill_sensors_height / 2\n", + " debug_draw.draw_segment(left, right, (1, 0, 0), line_width=0.4)\n", + "\n", + "\n", + "class FindGoos(b2d.QueryCallback):\n", + " def __init__(self):\n", + " super(FindGoos, self).__init__()\n", + " self.goos = []\n", + "\n", + " def report_fixture(self, fixture):\n", + " body = fixture.body\n", + " if body.user_data == \"goo\":\n", + " self.goos.append(body)\n", + " return True\n", + "\n", + "\n", + "class Goo(TestbedBase):\n", + "\n", + " name = \"Goo\"\n", + "\n", + " def __init__(self, settings=None):\n", + " super(Goo, self).__init__(settings=settings)\n", + "\n", + " self.goo_graph = networkx.Graph()\n", + " self.level = Level(testbed=self)\n", + "\n", + " # mouse related\n", + " self.last_mouse_pos = None\n", + " self.is_mouse_down = False\n", + " self.could_place_goo_when_mouse_was_down = False\n", + "\n", + " # callback to draw tentative placement\n", + " self.draw_callback = None\n", + "\n", + " # goos marked for destruction\n", + " self.goo_to_destroy = []\n", + "\n", + " # joints marked for destruction\n", + " self.joints_to_destroy = []\n", + " self.gamma = 0.003\n", + " self.break_threshold = 0.5\n", + "\n", + " # time point when goo can be inserted\n", + " self.insert_time_point = 0\n", + " self.insert_delay = 1.0\n", + "\n", + " # handle finishing of level\n", + " self.with_goal_contact = dict()\n", + "\n", + " # amount of seconds one has to be in the finishing zone\n", + " self.win_delay = 3.0\n", + "\n", + " # particle system will be defined an used on win!\n", + " # this is then used for some kind of fireworks\n", + " self.psystem = None\n", + " self.emitter = None\n", + " self.emitter_stop_time = None\n", + " self.emitter_start_time = None\n", + "\n", + " # trigger some fireworks on win\n", + " def on_win(self, win_body):\n", + "\n", + " if self.psystem is None:\n", + " # particle system\n", + " pdef = b2d.particle_system_def(\n", + " viscous_strength=0.9,\n", + " spring_strength=0.0,\n", + " damping_strength=100.5,\n", + " pressure_strength=1.0,\n", + " color_mixing_strength=0.05,\n", + " density=0.1,\n", + " )\n", + "\n", + " self.psystem = self.world.create_particle_system(pdef)\n", + " self.psystem.radius = 0.1\n", + " self.psystem.damping = 0.5\n", + "\n", + " emitter_def = b2d.RandomizedRadialEmitterDef()\n", + " emitter_def.emite_rate = 2000\n", + " emitter_def.lifetime = 0.9\n", + " emitter_def.enabled = True\n", + " emitter_def.inner_radius = 0.0\n", + " emitter_def.outer_radius = 0.1\n", + " emitter_def.velocity_magnitude = 1000.0\n", + " emitter_def.start_angle = 0\n", + " emitter_def.stop_angle = 2 * math.pi\n", + " emitter_def.transform = b2d.Transform(\n", + " win_body.position + b2d.vec2(0, 20), b2d.Rot(0)\n", + " )\n", + " self.emitter = b2d.RandomizedRadialEmitter(self.psystem, emitter_def)\n", + " self.emitter_stop_time = self.elapsed_time + 0.2\n", + "\n", + " def draw_goo(self, pos, angle, body=None):\n", + " self.debug_draw.draw_solid_circle(pos, 1, axis=None, color=(1, 0, 1))\n", + " self.debug_draw.draw_circle(pos, 1.1, (1, 1, 1), line_width=0.1)\n", + "\n", + " if body is not None:\n", + " centers = [\n", + " body.get_world_point((-0.3, 0.2)),\n", + " body.get_world_point((0.3, 0.2)),\n", + " ]\n", + " for center in centers:\n", + " self.debug_draw.draw_solid_circle(\n", + " center, 0.4, axis=None, color=(1, 1, 1)\n", + " )\n", + " self.debug_draw.draw_solid_circle(\n", + " center, 0.2, axis=None, color=(0, 0, 0)\n", + " )\n", + "\n", + " def draw_edge(self, pos_a, pos_b, stress):\n", + " no_stress = numpy.array([1, 1, 1])\n", + " has_stress = numpy.array([1, 0, 0])\n", + " color = (1.0 - stress) * no_stress + stress * has_stress\n", + " color = tuple([float(c) for c in color])\n", + " self.debug_draw.draw_segment(pos_a, pos_b, color=color, line_width=0.4)\n", + "\n", + " def insert_goo(self, pos, static=False):\n", + " if static:\n", + " f = self.world.create_static_body\n", + " else:\n", + " f = self.world.create_dynamic_body\n", + "\n", + " goo = f(\n", + " position=pos,\n", + " fixtures=b2d.fixture_def(shape=b2d.circle_shape(radius=1), density=1),\n", + " user_data=\"goo\",\n", + " )\n", + " self.goo_graph.add_node(goo)\n", + " return goo\n", + "\n", + " def connect_goos(self, goo_a, goo_b):\n", + " length = (goo_a.position - goo_b.position).length\n", + " joint = self.world.create_distance_joint(\n", + " goo_a,\n", + " goo_b,\n", + " stiffness=500,\n", + " damping=0.1,\n", + " length=length,\n", + " user_data=dict(length=length, stress=0),\n", + " )\n", + " self.goo_graph.add_edge(goo_a, goo_b, joint=joint)\n", + "\n", + " def query_placement(self, pos):\n", + "\n", + " radius = 8\n", + "\n", + " # find all goos in around pos\n", + " pos = b2d.vec2(pos)\n", + " box = b2d.aabb(\n", + " lower_bound=pos - b2d.vec2(radius, radius),\n", + " upper_bound=pos + b2d.vec2(radius, radius),\n", + " )\n", + " query = FindGoos()\n", + " self.world.query_aabb(query, box)\n", + " goos = query.goos\n", + " n_goos = len(goos)\n", + "\n", + " if n_goos >= 2:\n", + "\n", + " # try to insert to goo as edge between\n", + " # 2 existing goos\n", + " def distance(a, b, p):\n", + " if self.goo_graph.has_edge(a[0], b[0]):\n", + " return float(\"inf\")\n", + " return numpy.linalg.norm((a[1] + b[1]) / 2 - p)\n", + "\n", + " i, j, best_dist = best_pairwise_distance(\n", + " goos,\n", + " f=lambda goo: (goo, numpy.array(goo.position)),\n", + " distance=partial(distance, p=pos),\n", + " )\n", + "\n", + " if best_dist < 0.8:\n", + "\n", + " def draw_callback():\n", + " self.draw_edge(goos[i].position, goos[j].position, stress=0)\n", + "\n", + " def insert_callack():\n", + " self.connect_goos(goos[i], goos[j])\n", + "\n", + " return True, draw_callback, insert_callack\n", + "\n", + " # try to insert the goo as brand new\n", + " # goo and connect it with 2 existing goos\n", + " f = lambda goo: (goo, (goo.position - b2d.vec2(pos)).length)\n", + "\n", + " def distance(a, b):\n", + " if not self.goo_graph.has_edge(a[0], b[0]):\n", + " return float(\"inf\")\n", + " return a[1] + b[1]\n", + "\n", + " i, j, best_dist = best_pairwise_distance(goos, f=f, distance=distance)\n", + " if best_dist < float(\"inf\"):\n", + "\n", + " def draw_callback():\n", + "\n", + " self.draw_edge(pos, goos[i].position, stress=0)\n", + " self.draw_edge(pos, goos[j].position, stress=0)\n", + " self.draw_goo(pos, angle=None)\n", + "\n", + " def insert_callack():\n", + " goo = self.insert_goo(pos=pos)\n", + " self.connect_goos(goo, goos[i])\n", + " self.connect_goos(goo, goos[j])\n", + "\n", + " return True, draw_callback, insert_callack\n", + "\n", + " return False, None, None\n", + "\n", + " def on_mouse_down(self, pos):\n", + " self.last_mouse_pos = pos\n", + " self.is_mouse_down = True\n", + " can_be_placed, draw_callback, insert_callback = self.query_placement(pos)\n", + " self.could_place_goo_when_mouse_was_down = can_be_placed\n", + " if can_be_placed:\n", + " if self.elapsed_time < self.insert_time_point:\n", + " return True\n", + " self.draw_callback = draw_callback\n", + " return True\n", + " return False\n", + "\n", + " def on_mouse_move(self, pos):\n", + " self.last_mouse_pos = pos\n", + " if self.is_mouse_down:\n", + " can_be_placed, draw_callback, insert_callback = self.query_placement(pos)\n", + " if can_be_placed:\n", + " if self.elapsed_time < self.insert_time_point:\n", + " return True\n", + " self.draw_callback = draw_callback\n", + " return True\n", + " else:\n", + " self.draw_callback = None\n", + " return self.could_place_goo_when_mouse_was_down\n", + "\n", + " def on_mouse_up(self, pos):\n", + " self.last_mouse_pos = pos\n", + " self.is_mouse_down = False\n", + " self.draw_callback = None\n", + " can_be_placed, draw_callback, insert_callback = self.query_placement(pos)\n", + " if can_be_placed:\n", + " if self.elapsed_time < self.insert_time_point:\n", + " return True\n", + " # self.draw_callback = draw_callback\n", + " insert_callback()\n", + " self.insert_time_point = self.elapsed_time + self.insert_delay\n", + " return True\n", + " return False\n", + "\n", + " def begin_contact(self, contact):\n", + " body_a = contact.body_a\n", + " body_b = contact.body_b\n", + " if body_b.user_data == \"goo\":\n", + " body_a, body_b = body_b, body_a\n", + "\n", + " user_data_a = body_a.user_data\n", + " user_data_b = body_b.user_data\n", + " if body_a.user_data == \"goo\":\n", + " if user_data_b == \"destroyer\":\n", + " self.goo_to_destroy.append(body_a)\n", + " elif user_data_b == \"goal\":\n", + " self.with_goal_contact[body_a] = self.elapsed_time + self.win_delay\n", + "\n", + " def end_contact(self, contact):\n", + " body_a = contact.body_a\n", + " body_b = contact.body_b\n", + " if body_b.user_data == \"goo\":\n", + " body_a, body_b = body_b, body_a\n", + "\n", + " user_data_a = body_a.user_data\n", + " user_data_b = body_b.user_data\n", + " if body_a.user_data == \"goo\":\n", + " if user_data_b == \"goal\":\n", + " if body_a in self.with_goal_contact:\n", + " del self.with_goal_contact[body_a]\n", + "\n", + " def pre_step(self, dt):\n", + "\n", + " # query if goo can be inserted\n", + " if (\n", + " self.is_mouse_down\n", + " and self.last_mouse_pos is not None\n", + " and self.draw_callback is None\n", + " ):\n", + " can_be_placed, draw_callback, insert_callback = self.query_placement(\n", + " self.last_mouse_pos\n", + " )\n", + " if can_be_placed and self.elapsed_time >= self.insert_time_point:\n", + " self.draw_callback = draw_callback\n", + "\n", + " # compute joint stress\n", + " for goo_a, goo_b, joint in self.goo_graph.edges(data=\"joint\"):\n", + " jd = joint.user_data\n", + "\n", + " # distance based stress\n", + " insert_length = jd[\"length\"]\n", + " length = (goo_a.position - goo_b.position).length\n", + "\n", + " d = length - insert_length\n", + " if d > 0:\n", + "\n", + " # reaction force based stress\n", + " rf = joint.get_reaction_force(30).length\n", + "\n", + " normalized_rf = 1.0 - math.exp(-rf * self.gamma)\n", + "\n", + " jd[\"stress\"] = normalized_rf / self.break_threshold\n", + " if normalized_rf > self.break_threshold:\n", + " self.joints_to_destroy.append((goo_a, goo_b, joint))\n", + "\n", + " else:\n", + " jd[\"stress\"] = 0\n", + "\n", + " for goo_a, goo_b, joint in self.joints_to_destroy:\n", + " self.goo_graph.remove_edge(u=goo_a, v=goo_b)\n", + " self.world.destroy_joint(joint)\n", + " self.joints_to_destroy = []\n", + "\n", + " # destroy goos\n", + " for goo in self.goo_to_destroy:\n", + " self.goo_graph.remove_node(goo)\n", + " self.world.destroy_body(goo)\n", + "\n", + " # destroy all with wrong degree\n", + " while True:\n", + " destroyed_any = False\n", + " to_remove = []\n", + " for goo in self.goo_graph.nodes:\n", + " if self.goo_graph.degree(goo) < 2:\n", + " destroyed_any = True\n", + " to_remove.append(goo)\n", + " if not destroyed_any:\n", + " break\n", + " for goo in to_remove:\n", + " self.goo_graph.remove_node(goo)\n", + " self.world.destroy_body(goo)\n", + " self.goo_to_destroy = []\n", + "\n", + " # check if we are done\n", + " for goo, finish_time in self.with_goal_contact.items():\n", + " if finish_time <= self.elapsed_time:\n", + " self.on_win(goo)\n", + "\n", + " if self.emitter is not None:\n", + " if self.emitter_stop_time is not None:\n", + " if self.elapsed_time > self.emitter_stop_time:\n", + " self.emitter.enabled = False\n", + " self.emitter_start_time = self.elapsed_time + 0.4\n", + " self.emitter_stop_time = None\n", + " p = list(self.emitter.position)\n", + " p[0] += (random.random() - 0.5) * 10.0\n", + " p[1] += (random.random() - 0.5) * 2.0\n", + " self.emitter.position = p\n", + " if self.emitter_start_time is not None:\n", + " if self.elapsed_time > self.emitter_start_time:\n", + " self.emitter.enabled = True\n", + " self.emitter_start_time = None\n", + " self.emitter_stop_time = self.elapsed_time + 0.2\n", + " self.emitter.step(dt)\n", + "\n", + " def post_debug_draw(self):\n", + "\n", + " self.level.draw(self.debug_draw)\n", + "\n", + " # draw mouse when mouse is down\n", + " if (\n", + " self.is_mouse_down\n", + " and self.last_mouse_pos is not None\n", + " and self.draw_callback is None\n", + " ):\n", + " d = (self.insert_time_point - self.elapsed_time) / self.insert_delay\n", + " if d > 0:\n", + " d = d * math.pi * 2\n", + " x = math.sin(d)\n", + " y = math.cos(d)\n", + " p = self.last_mouse_pos[0] + x, self.last_mouse_pos[1] + y\n", + " self.debug_draw.draw_segment(\n", + " p, self.last_mouse_pos, color=(1, 0, 0), line_width=0.2\n", + " )\n", + " self.debug_draw.draw_circle(\n", + " self.last_mouse_pos, 1, (1, 0, 0), line_width=0.2\n", + " )\n", + "\n", + " # draw the tentative placement\n", + " if self.draw_callback is not None:\n", + " self.draw_callback()\n", + "\n", + " for goo_a, goo_b, joint in self.goo_graph.edges(data=\"joint\"):\n", + " self.draw_edge(\n", + " goo_a.position, goo_b.position, stress=joint.user_data[\"stress\"]\n", + " )\n", + "\n", + " for goo in self.goo_graph:\n", + " self.draw_goo(goo.position, goo.angle, body=goo)\n" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# Controlls\n", + "* To play this game, click and drag next to the existing \"goos\"\n", + "* try to bridge the tiny gap\n", + "* Use the mouse-wheel to zoom in/out, a\n", + "* Click and drag in the empty space to translate the view." + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [ + "\n", + "s = JupyterAsyncGui.Settings()\n", + "s.resolution = [1000,500]\n", + "s.scale = 8\n", + "tb = b2d.testbed.run(Goo, backend=JupyterAsyncGui, gui_settings=s);" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": {}, + "outputs": [], + "source": [] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python 3 (ipykernel)", + "language": "python", + "name": "python3" + }, + "language_info": { + "codemirror_mode": { + "name": "ipython", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.10.4" + } + }, + "nbformat": 4, + "nbformat_minor": 4 +} diff --git a/content/pyodide/pyb2d/games/rocket.ipynb b/content/pyodide/pyb2d/games/rocket.ipynb new file mode 100644 index 0000000..316e9ce --- /dev/null +++ b/content/pyodide/pyb2d/games/rocket.ipynb @@ -0,0 +1,282 @@ +{ + "cells": [ + { + "cell_type": "code", + "execution_count": null, + "id": "f7b8452d-61fe-4356-8084-cac603096fef", + "metadata": {}, + "outputs": [], + "source": [ + "import sys\n", + "if \"pyodide\" in sys.modules:\n", + " import piplite\n", + " await piplite.install('pyb2d-jupyterlite-backend>=0.4.2')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "0bfa61e4-9817-4bea-aa66-6a660a423ae6", + "metadata": {}, + "outputs": [], + "source": [ + "from b2d.testbed import TestbedBase\n", + "import random\n", + "import numpy\n", + "import b2d\n", + "import math\n", + "\n", + "class Rocket(TestbedBase):\n", + "\n", + " name = \"Rocket\"\n", + "\n", + " def __init__(self, settings=None):\n", + " super(Rocket, self).__init__(gravity=(0, 0), settings=settings)\n", + "\n", + " # gravitational constant\n", + " self.gravitational_constant = 6.0\n", + "\n", + " self.planets = {}\n", + "\n", + " # home planet\n", + " home_planet = self.world.create_kinematic_body(\n", + " position=(10, 0),\n", + " fixtures=b2d.fixture_def(shape=b2d.circle_shape(radius=20)),\n", + " user_data=\"home_planet\",\n", + " )\n", + "\n", + " # target planet\n", + " target_planet = self.world.create_kinematic_body(\n", + " position=(100, 100),\n", + " fixtures=b2d.fixture_def(shape=b2d.circle_shape(radius=10)),\n", + " user_data=\"target_planet\",\n", + " )\n", + "\n", + " # black hole\n", + " black_hole = self.world.create_kinematic_body(\n", + " position=(0, 400),\n", + " fixtures=b2d.fixture_def(shape=b2d.circle_shape(radius=1)),\n", + " user_data=\"black_hole\",\n", + " )\n", + "\n", + " self.planets = {\n", + " home_planet: dict(radius=20, density=1, color=(0, 0.2, 1)),\n", + " target_planet: dict(radius=10, density=1, color=(0.7, 0.7, 0.7)),\n", + " black_hole: dict(radius=1, density=10000, color=(0.1, 0.1, 0.1)),\n", + " }\n", + "\n", + " # a tiny rocket\n", + " self.rocket = self.world.create_dynamic_body(\n", + " position=(10, 10),\n", + " fixtures=[\n", + " b2d.fixture_def(shape=b2d.polygon_shape(box=[1, 1]), density=1),\n", + " b2d.fixture_def(\n", + " shape=b2d.polygon_shape(vertices=[(-1, 1), (0, 4), (1, 1)]),\n", + " density=1,\n", + " ),\n", + " ],\n", + " angular_damping=0.5,\n", + " linear_damping=0.2,\n", + " user_data=\"rocket\",\n", + " )\n", + " # check if the rocket is gone\n", + " self.touched_black_hole = False\n", + "\n", + " # particle system\n", + " pdef = b2d.particle_system_def(\n", + " viscous_strength=0.9,\n", + " spring_strength=0.0,\n", + " damping_strength=100.5,\n", + " pressure_strength=1.0,\n", + " color_mixing_strength=0.05,\n", + " density=0.1,\n", + " )\n", + "\n", + " psystem = self.world.create_particle_system(pdef)\n", + " psystem.radius = 0.1\n", + " psystem.damping = 0.5\n", + "\n", + " self.emitters = []\n", + " self.key_map = {\"w\": 0, \"a\": 1, \"d\": 2}\n", + "\n", + " angle_width = (math.pi * 2) / 16\n", + " emitter_def = b2d.RandomizedRadialEmitterDef()\n", + " emitter_def.emite_rate = 2000\n", + " emitter_def.lifetime = 1.0\n", + " emitter_def.enabled = False\n", + " emitter_def.inner_radius = 1\n", + " emitter_def.outer_radius = 1\n", + " emitter_def.velocity_magnitude = 10.0\n", + " emitter_def.start_angle = math.pi / 2 - angle_width / 2.0\n", + " emitter_def.stop_angle = math.pi / 2 + angle_width / 2.0\n", + " emitter_def.body = self.rocket\n", + "\n", + " delta = 0.2\n", + " self.emitter_local_anchors = [\n", + " (0, -delta), # main\n", + " (-delta, -0.5), # left,\n", + " (delta, -0.5), # right\n", + " ]\n", + " self.emitter_local_rot = [math.pi, math.pi / 2, -math.pi / 2] # main\n", + "\n", + " # main trust\n", + " emitter_def.emite_rate = 2000\n", + " world_anchor = self.rocket.get_world_point(self.emitter_local_anchors[0])\n", + " emitter_def.transform = b2d.Transform(\n", + " world_anchor, b2d.Rot(self.emitter_local_rot[0])\n", + " )\n", + " emitter = b2d.RandomizedRadialEmitter(psystem, emitter_def)\n", + " self.emitters.append(emitter)\n", + "\n", + " # left\n", + " emitter_def.emite_rate = 200\n", + " world_anchor = self.rocket.get_world_point(self.emitter_local_anchors[1])\n", + " emitter_def.transform = b2d.Transform(\n", + " world_anchor, b2d.Rot(self.emitter_local_rot[1])\n", + " )\n", + " emitter = b2d.RandomizedRadialEmitter(psystem, emitter_def)\n", + " self.emitters.append(emitter)\n", + "\n", + " # right\n", + " emitter_def.emite_rate = 200\n", + " world_anchor = self.rocket.get_world_point(self.emitter_local_anchors[1])\n", + " emitter_def.transform = b2d.Transform(\n", + " world_anchor, b2d.Rot(self.emitter_local_rot[1])\n", + " )\n", + " emitter = b2d.RandomizedRadialEmitter(psystem, emitter_def)\n", + " self.emitters.append(emitter)\n", + "\n", + " def pre_step(self, dt):\n", + "\n", + " # check if the rocket has died\n", + " if self.touched_black_hole:\n", + " if self.rocket is not None:\n", + " self.world.destroy_body(self.rocket)\n", + " self.rocket = None\n", + " else:\n", + " rocket_center = self.rocket.world_center\n", + " rocket_mass = self.rocket.mass\n", + " # compute gravitational forces\n", + " net_force = numpy.zeros([2])\n", + " for planet, planet_def in self.planets.items():\n", + " radius = planet_def[\"radius\"]\n", + " planet_center = planet.position\n", + " planet_mass = planet_def[\"density\"] * radius ** 2 * math.pi\n", + " delta = rocket_center - planet_center\n", + " distance = delta.normalize()\n", + " f = (\n", + " -self.gravitational_constant\n", + " * rocket_mass\n", + " * planet_mass\n", + " / (distance * distance)\n", + " )\n", + " net_force += delta * f\n", + " f = float(net_force[0]), float(net_force[1])\n", + " self.rocket.apply_force_to_center(f)\n", + "\n", + " # run the rockets engines\n", + " for emitter, local_anchor, local_rotation in zip(\n", + " self.emitters, self.emitter_local_anchors, self.emitter_local_rot\n", + " ):\n", + " world_anchor = self.rocket.get_world_point(local_anchor)\n", + " emitter.position = world_anchor\n", + " emitter.angle = self.rocket.angle + local_rotation\n", + " emitter.step(dt)\n", + "\n", + " def begin_contact(self, contact):\n", + " body_a = contact.body_a\n", + " body_b = contact.body_b\n", + " if body_b.user_data == \"rocket\":\n", + " body_a, body_b = body_b, body_a\n", + "\n", + " user_data_a = body_a.user_data\n", + " user_data_b = body_b.user_data\n", + " if body_a.user_data == \"rocket\":\n", + " if user_data_b == \"black_hole\":\n", + " self.touched_black_hole = True\n", + "\n", + " def on_keyboard_down(self, key):\n", + " if key in self.key_map:\n", + " self.emitters[self.key_map[key]].enabled = True\n", + " return True\n", + " return False\n", + "\n", + " def on_keyboard_up(self, key):\n", + " if key in self.key_map:\n", + " self.emitters[self.key_map[key]].enabled = False\n", + " return False\n", + " return False\n", + "\n", + " def pre_debug_draw(self):\n", + " pass\n", + "\n", + " def post_debug_draw(self):\n", + " for planet, planet_def in self.planets.items():\n", + " pos = planet.position\n", + " self.debug_draw.draw_solid_circle(\n", + " pos, planet_def[\"radius\"] + 0.1, axis=None, color=planet_def[\"color\"]\n", + " )\n", + " if planet.user_data == \"black_hole\":\n", + " self.debug_draw.draw_circle(\n", + " pos, planet_def[\"radius\"] * 5, color=(1, 1, 1), line_width=0.1\n", + " )" + ] + }, + { + "cell_type": "markdown", + "id": "357866b3-876e-421f-8d2a-77d6697551d3", + "metadata": {}, + "source": [ + "# Controlls\n", + "* To play this game, use 'w','a','s','d' on your keyboard to steer the rocket\n", + "* try to land on the other planet\n", + "* avoid the black hole\n", + "* Use the mouse-wheel to zoom in/out, a\n", + "* Click and drag in the empty space to translate the view." + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "7bab75b7-cec1-4348-b95d-9ffd282ded5c", + "metadata": {}, + "outputs": [], + "source": [ + "from pyb2d_jupyterlite_backend.async_jupyter_gui import JupyterAsyncGui\n", + "s = JupyterAsyncGui.Settings()\n", + "s.resolution = [1000,1000]\n", + "s.scale = 3\n", + "tb = b2d.testbed.run(Rocket, backend=JupyterAsyncGui, gui_settings=s);" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "674c57c8-b5b1-45a9-b75e-5ddc487f7d9b", + "metadata": {}, + "outputs": [], + "source": [] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python 3 (ipykernel)", + "language": "python", + "name": "python3" + }, + "language_info": { + "codemirror_mode": { + "name": "ipython", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.10.4" + } + }, + "nbformat": 4, + "nbformat_minor": 5 +} diff --git a/content/pyodide/pyb2d/gauss_machine.ipynb b/content/pyodide/pyb2d/gauss_machine.ipynb new file mode 100644 index 0000000..b7bb72c --- /dev/null +++ b/content/pyodide/pyb2d/gauss_machine.ipynb @@ -0,0 +1,128 @@ +{ + "cells": [ + { + "cell_type": "code", + "execution_count": null, + "id": "39a80aae-a990-4ed8-b880-3db2e7f70f16", + "metadata": {}, + "outputs": [], + "source": [ + "import sys\n", + "if \"pyodide\" in sys.modules:\n", + " import piplite\n", + " await piplite.install('pyb2d-jupyterlite-backend>=0.4.2')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "9d9f8d68-0f3b-49c1-9512-e3e8344e7342", + "metadata": {}, + "outputs": [], + "source": [ + "from b2d.testbed import TestbedBase\n", + "import random\n", + "import numpy\n", + "import b2d\n", + "\n", + "\n", + "class GaussMachine(TestbedBase):\n", + "\n", + " name = \"Gauss Machine\"\n", + "\n", + " def __init__(self, settings=None):\n", + " super(GaussMachine, self).__init__(settings=settings)\n", + "\n", + " self.box_shape = 30, 20\n", + " box_shape = self.box_shape\n", + "\n", + " # outer box\n", + " verts = numpy.array(\n", + " [(0, box_shape[1]), (0, 0), (box_shape[0], 0), (box_shape[0], box_shape[1])]\n", + " )\n", + " shape = b2d.chain_shape(vertices=numpy.flip(verts, axis=0))\n", + " box = self.world.create_static_body(position=(0, 0), shape=shape)\n", + "\n", + " # \"bins\"\n", + " bin_height = box_shape[1] / 3\n", + " bin_width = 1\n", + " for x in range(0, box_shape[0], bin_width):\n", + " box = self.world.create_static_body(\n", + " position=(0, 0), shape=b2d.two_sided_edge_shape((x, 0), (x, bin_height))\n", + " )\n", + "\n", + " # reflectors\n", + " ref_start_y = int(bin_height + box_shape[1] / 10.0)\n", + " ref_stop_y = int(box_shape[1] * 0.9)\n", + " for x in range(0, box_shape[0] + 1):\n", + "\n", + " for y in range(ref_start_y, ref_stop_y):\n", + " s = [0.5, 0][y % 2 == 0]\n", + " shape = b2d.circle_shape(radius=0.3)\n", + " box = self.world.create_static_body(position=(x + s, y), shape=shape)\n", + "\n", + " # particle system\n", + " pdef = b2d.particle_system_def(\n", + " viscous_strength=0.9,\n", + " spring_strength=0.0,\n", + " damping_strength=100.5,\n", + " pressure_strength=1.0,\n", + " color_mixing_strength=0.05,\n", + " density=2,\n", + " )\n", + "\n", + " psystem = self.world.create_particle_system(pdef)\n", + " psystem.radius = 0.1\n", + " psystem.damping = 0.5\n", + "\n", + " # linear emitter\n", + " emitter_pos = (self.box_shape[0] / 2, self.box_shape[1] + 10)\n", + " emitter_def = b2d.RandomizedLinearEmitterDef()\n", + " emitter_def.emite_rate = 400\n", + " emitter_def.lifetime = 25\n", + " emitter_def.size = (10, 1)\n", + " emitter_def.transform = b2d.Transform(emitter_pos, b2d.Rot(0))\n", + "\n", + " self.emitter = b2d.RandomizedLinearEmitter(psystem, emitter_def)\n", + "\n", + " def pre_step(self, dt):\n", + " self.emitter.step(dt)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "51e5df1b-f5e6-486a-a6c0-173597198e5d", + "metadata": {}, + "outputs": [], + "source": [ + "from pyb2d_jupyterlite_backend.async_jupyter_gui import JupyterAsyncGui\n", + "s = JupyterAsyncGui.Settings()\n", + "s.resolution = [350,400]\n", + "s.scale = 11\n", + "tb = b2d.testbed.run(GaussMachine, backend=JupyterAsyncGui, gui_settings=s);" + ] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python 3 (ipykernel)", + "language": "python", + "name": "python3" + }, + "language_info": { + "codemirror_mode": { + "name": "ipython", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.10.4" + } + }, + "nbformat": 4, + "nbformat_minor": 5 +} diff --git a/content/pyodide/pyb2d/newtons_cradle.ipynb b/content/pyodide/pyb2d/newtons_cradle.ipynb new file mode 100644 index 0000000..9ef3ff3 --- /dev/null +++ b/content/pyodide/pyb2d/newtons_cradle.ipynb @@ -0,0 +1,130 @@ +{ + "cells": [ + { + "cell_type": "code", + "execution_count": 1, + "id": "82ae535a-a041-40f0-8c40-e689b894b0bc", + "metadata": {}, + "outputs": [], + "source": [ + "import sys\n", + "if \"pyodide\" in sys.modules:\n", + " import piplite\n", + " await piplite.install('pyb2d-jupyterlite-backend>=0.4.0')" + ] + }, + { + "cell_type": "code", + "execution_count": 2, + "id": "7381ff66-7924-4216-b141-8f7b15ed038a", + "metadata": {}, + "outputs": [], + "source": [ + "from b2d.testbed import TestbedBase\n", + "import b2d\n", + "\n", + "\n", + "class NewtonsCradle(TestbedBase):\n", + "\n", + " name = \"newton's cradle\"\n", + "\n", + " def __init__(self, settings=None):\n", + " super(NewtonsCradle, self).__init__(settings=settings)\n", + "\n", + " # radius of the circles\n", + " r = 1.0\n", + " # length of the rope\n", + " l = 10.0\n", + " # how many balls\n", + " n = 10\n", + "\n", + " offset = (l + r, 2 * r)\n", + " dynamic_circles = []\n", + " static_bodies = []\n", + " for i in range(n):\n", + " if i + 1 == n:\n", + " position = (offset[0] + i * 2 * r + l, offset[1] + l)\n", + " else:\n", + " position = (offset[0] + i * 2 * r, offset[1])\n", + "\n", + " circle = self.world.create_dynamic_body(\n", + " position=position,\n", + " fixtures=b2d.fixture_def(\n", + " shape=b2d.circle_shape(radius=r * 0.90),\n", + " density=1.0,\n", + " restitution=1.0,\n", + " friction=0.0,\n", + " ),\n", + " linear_damping=0.01,\n", + " angular_damping=1.0,\n", + " fixed_rotation=True,\n", + " )\n", + " dynamic_circles.append(circle)\n", + "\n", + " static_body = self.world.create_static_body(\n", + " position=(offset[0] + i * 2 * r, offset[1] + l)\n", + " )\n", + "\n", + " self.world.create_distance_joint(\n", + " static_body,\n", + " circle,\n", + " local_anchor_a=(0, 0),\n", + " local_anchor_b=(0, 0),\n", + " max_length=l,\n", + " stiffness=0,\n", + " )\n", + "\n", + " static_bodies.append(static_body)" + ] + }, + { + "cell_type": "code", + "execution_count": 3, + "id": "6f694d32-8b23-40cf-91c3-0edd6abb658d", + "metadata": {}, + "outputs": [ + { + "data": { + "application/vnd.jupyter.widget-view+json": { + "model_id": "b24ad88f6cfd4db19fc3145000e79635", + "version_major": 2, + "version_minor": 0 + }, + "text/plain": [ + "Output()" + ] + }, + "metadata": {}, + "output_type": "display_data" + } + ], + "source": [ + "from pyb2d_jupyterlite_backend.async_jupyter_gui import JupyterAsyncGui\n", + "s = JupyterAsyncGui.Settings()\n", + "s.resolution = [1000,300]\n", + "b2d.testbed.run(NewtonsCradle, backend=JupyterAsyncGui, gui_settings=s);" + ] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python 3 (ipykernel)", + "language": "python", + "name": "python3" + }, + "language_info": { + "codemirror_mode": { + "name": "ipython", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.10.4" + } + }, + "nbformat": 4, + "nbformat_minor": 5 +} diff --git a/content/pyodide/renderers.ipynb b/content/pyodide/renderers.ipynb new file mode 100644 index 0000000..286490f --- /dev/null +++ b/content/pyodide/renderers.ipynb @@ -0,0 +1 @@ +{"metadata":{"language_info":{"codemirror_mode":{"name":"python","version":3},"file_extension":".py","mimetype":"text/x-python","name":"python","nbconvert_exporter":"python","pygments_lexer":"ipython3","version":"3.8"},"kernelspec":{"name":"python","display_name":"Pyolite","language":"python"}},"nbformat_minor":4,"nbformat":4,"cells":[{"cell_type":"markdown","source":"# JupyterLab Renderers","metadata":{}},{"cell_type":"markdown","source":"## FASTA","metadata":{}},{"cell_type":"code","source":"def Fasta(data=''):\n bundle = {}\n bundle['application/vnd.fasta.fasta'] = data\n bundle['text/plain'] = data\n display(bundle, raw=True)\n\nFasta(\"\"\">SEQUENCE_1\nMTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG\nLVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK\nIPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL\nMGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL\n>SEQUENCE_2\nSATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI\nATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH\"\"\")","metadata":{"trusted":true},"execution_count":null,"outputs":[]},{"cell_type":"markdown","source":"## GeoJSON","metadata":{}},{"cell_type":"code","source":"def GeoJSON(data):\n bundle = {}\n bundle['application/geo+json'] = data\n bundle['text/plain'] = data\n display(bundle, raw=True)\n \nGeoJSON({\n \"type\": \"Feature\",\n \"geometry\": {\n \"type\": \"Point\",\n \"coordinates\": [125.6, 10.1]\n },\n \"properties\": {\n \"name\": \"Dinagat Islands\"\n }\n})","metadata":{"trusted":true},"execution_count":null,"outputs":[]},{"cell_type":"code","source":"","metadata":{},"execution_count":null,"outputs":[]}]} \ No newline at end of file diff --git a/content/python.ipynb b/content/python.ipynb new file mode 100644 index 0000000..689e883 --- /dev/null +++ b/content/python.ipynb @@ -0,0 +1,721 @@ +{ + "cells": [ + { + "attachments": {}, + "cell_type": "markdown", + "metadata": { + "tags": [] + }, + "source": [ + "# A Python kernel backed by Pyodide\n", + "\n", + "![](https://raw.githubusercontent.com/pyodide/pyodide/master/docs/_static/img/pyodide-logo.png)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import pyodide_kernel\n", + "pyodide_kernel.__version__" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# Simple code execution" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "a = 3" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "a" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "b = 89\n", + "\n", + "def sq(x):\n", + " return x * x\n", + "\n", + "sq(b)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "print" + ] + }, + { + "cell_type": "markdown", + "metadata": { + "tags": [] + }, + "source": [ + "# Redirected streams" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import sys\n", + "\n", + "print(\"Error !!\", file=sys.stderr)" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# Error handling" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "scrolled": true, + "trusted": true + }, + "outputs": [], + "source": [ + "\"Hello\"\n", + "\n", + "def dummy_function():\n", + " import missing_module" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "dummy_function()" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# Code completion" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "### press `tab` to see what is available in `sys` module" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "from sys import " + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# Code inspection" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "### using the question mark" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "?print" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "### by pressing `shift+tab`" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "print(" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# Input support" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "name = await input('Enter your name: ')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "'Hello, ' + name" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "# Rich representation" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "from IPython.display import display, Markdown, HTML, JSON, Latex" + ] + }, + { + "cell_type": "markdown", + "metadata": { + "tags": [] + }, + "source": [ + "## HTML" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "print('Before display')\n", + "\n", + "s = '

HTML Title

'\n", + "display(HTML(s))\n", + "\n", + "print('After display')" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Markdown" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "Markdown('''\n", + "# Title\n", + "\n", + "**in bold**\n", + "\n", + "~~Strikthrough~~\n", + "''')" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Pandas DataFrame" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import pandas as pd\n", + "import numpy as np\n", + "from string import ascii_uppercase as letters\n", + "from IPython.display import display\n", + "\n", + "df = pd.DataFrame(np.random.randint(0, 100, size=(100, len(letters))), columns=list(letters))\n", + "df" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "### Show the same DataFrame " + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "df" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## IPython.display module" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "from IPython.display import clear_output, display, update_display\n", + "from asyncio import sleep" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "### Update display" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "class Square:\n", + " color = 'PeachPuff'\n", + " def _repr_html_(self):\n", + " return '''\n", + "
\n", + "
''' % self.color\n", + "square = Square()\n", + "\n", + "display(square, display_id='some-square')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "square.color = 'OliveDrab'\n", + "update_display(square, display_id='some-square')" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "### Clear output" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "print(\"hello\")\n", + "await sleep(3)\n", + "clear_output() # will flicker when replacing \"hello\" with \"goodbye\"\n", + "print(\"goodbye\")" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "print(\"hello\")\n", + "await sleep(3)\n", + "clear_output(wait=True) # prevents flickering\n", + "print(\"goodbye\")" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "### Display classes" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "from IPython.display import HTML\n", + "HTML('''\n", + "
\n", + "
''')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "from IPython.display import Math\n", + "Math(r'F(k) = \\int_{-\\infty}^{\\infty} f(x) e^{2\\pi i k} dx')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "from IPython.display import Latex\n", + "Latex(r\"\"\"\\begin{eqnarray}\n", + "\\nabla \\times \\vec{\\mathbf{B}} -\\, \\frac1c\\, \\frac{\\partial\\vec{\\mathbf{E}}}{\\partial t} & = \\frac{4\\pi}{c}\\vec{\\mathbf{j}} \\\\\n", + "\\nabla \\cdot \\vec{\\mathbf{E}} & = 4 \\pi \\rho \\\\\n", + "\\nabla \\times \\vec{\\mathbf{E}}\\, +\\, \\frac1c\\, \\frac{\\partial\\vec{\\mathbf{B}}}{\\partial t} & = \\vec{\\mathbf{0}} \\\\\n", + "\\nabla \\cdot \\vec{\\mathbf{B}} & = 0 \n", + "\\end{eqnarray}\"\"\")" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "from IPython.display import ProgressBar\n", + "\n", + "for i in ProgressBar(10):\n", + " await sleep(0.1)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "from IPython.display import JSON\n", + "JSON(['foo', {'bar': ('baz', None, 1.0, 2)}], metadata={}, expanded=True, root='test')" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "from IPython.display import GeoJSON\n", + "GeoJSON(\n", + " data={\n", + " \"type\": \"Feature\",\n", + " \"geometry\": {\n", + " \"type\": \"Point\",\n", + " \"coordinates\": [11.8, -45.04]\n", + " }\n", + " }, url_template=\"http://s3-eu-west-1.amazonaws.com/whereonmars.cartodb.net/{basemap_id}/{z}/{x}/{y}.png\",\n", + " layer_options={\n", + " \"basemap_id\": \"celestia_mars-shaded-16k_global\",\n", + " \"attribution\" : \"Celestia/praesepe\",\n", + " \"tms\": True,\n", + " \"minZoom\" : 0,\n", + " \"maxZoom\" : 5\n", + " }\n", + ")" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Network requests and JSON" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import json\n", + "from js import fetch" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "res = await fetch('https://httpbin.org/get')\n", + "text = await res.text()\n", + "obj = json.loads(text) \n", + "JSON(obj)" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Sympy" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "from sympy import Integral, sqrt, symbols, init_printing\n", + "\n", + "init_printing()\n", + "\n", + "x = symbols('x')\n", + "\n", + "Integral(sqrt(1 / x), x)" + ] + }, + { + "cell_type": "markdown", + "metadata": {}, + "source": [ + "## Magics" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import os\n", + "os.listdir()" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "%cd /home" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "%pwd" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "current_path = %pwd\n", + "print(current_path)" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "%%writefile test.txt\n", + "\n", + "This will create a new file. \n", + "With the text that you see here." + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "%history" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "import time" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "metadata": { + "trusted": true + }, + "outputs": [], + "source": [ + "%%timeit \n", + "\n", + "time.sleep(0.1)" + ] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Python (Pyodide)", + "language": "python", + "name": "python" + }, + "language_info": { + "codemirror_mode": { + "name": "python", + "version": 3 + }, + "file_extension": ".py", + "mimetype": "text/x-python", + "name": "python", + "nbconvert_exporter": "python", + "pygments_lexer": "ipython3", + "version": "3.8" + }, + "orig_nbformat": 4 + }, + "nbformat": 4, + "nbformat_minor": 4 +} diff --git a/content/xeus-lua/canvas.ipynb b/content/xeus-lua/canvas.ipynb new file mode 100644 index 0000000..89f9e52 --- /dev/null +++ b/content/xeus-lua/canvas.ipynb @@ -0,0 +1,29 @@ +{ + "metadata": { + "orig_nbformat": 4, + "language_info": { + "file_extension": ".lua", + "mimetype": "text/x-luasrc", + "name": "lua", + "version": "14.0.0" + }, + "kernelspec": { + "name": "Lua", + "display_name": "Lua", + "language": "lua" + } + }, + "nbformat_minor": 4, + "nbformat": 4, + "cells": [ + { + "cell_type": "code", + "source": "canvas = ilua.canvas.canvas()\nilua.display.display(canvas)\ncanvas:cache()\nfor var=1,100 do\n canvas:begin_path()\n canvas:move_to(canvas:rand_coord())\n for s=1,10 do\n canvas:line_to(canvas:rand_coord())\n end\n canvas.fill_style = canvas:rand_color()\n canvas:fill()\nend\ncanvas:flush()", + "metadata": { + "trusted": true + }, + "execution_count": null, + "outputs": [] + } + ] +} \ No newline at end of file diff --git a/content/xeus-lua/game-of-life.ipynb b/content/xeus-lua/game-of-life.ipynb new file mode 100644 index 0000000..09dabe4 --- /dev/null +++ b/content/xeus-lua/game-of-life.ipynb @@ -0,0 +1,92 @@ +{ + "metadata":{ + "orig_nbformat":4, + "kernelspec":{ + "name":"Lua", + "display_name":"Lua", + "language":"lua" + }, + "language_info":{ + "file_extension":".lua", + "mimetype":"text/x-luasrc", + "name":"lua", + "version":"14.0.0" + } + }, + "nbformat_minor":5, + "nbformat":4, + "cells":[ + { + "cell_type":"code", + "source":"math = require(\"math\")\n\n-- the game of life class itself\nGameOfLife = {}\nGameOfLife.__index = GameOfLife\nfunction GameOfLife:Create(grid_size)\n local this =\n {\n grid_size = grid_size or {10,10},\n grid = {}\n }\n setmetatable(this, GameOfLife)\n this.size = this.grid_size[1] * this.grid_size[2]\n for i=1,this.size do\n this.grid[i] = 0\n end\n return this\nend", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ], + "id":"61dc1d13-5546-477d-a162-e18ec564e3ee" + }, + { + "cell_type":"code", + "source":"-- member function to initalize with some random values\nfunction GameOfLife:init_random(p)\n for i=1,self.size do\n self.grid[i] = (math.random() < p) and 1 or 0\n end\nend", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ], + "id":"72da5a15-dd9d-4a62-bfa3-5a3ec457c5f4" + }, + { + "cell_type":"code", + "source":"-- helper function to convert a coordinate {x,y} into a \n-- scalar offset\nfunction GameOfLife:to_offset(coord)\n return (coord[1]-1) * self.grid_size[2] + (coord[2] -1) + 1\nend\n-- helper function to access the value of the grid at a coordinate {x,y}\nfunction GameOfLife:at(coord)\n return self.grid[self:to_offset(coord)]\nend", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ], + "id":"0b341677-64f2-4ef3-8ea4-a8e2eb275df2" + }, + { + "cell_type":"code", + "source":"-- the function to do a step\nfunction GameOfLife:step()\n new_grid = {}\n \n for x=1,self.grid_size[1] do\n for y=1, self.grid_size[2] do\n \n local c = 0\n for xx=-1,1 do\n for yy=-1,1 do\n nx = x + xx\n ny = y + yy\n if nx >=1 and ny>=1 and nx <=self.grid_size[1] and ny <=self.grid_size[2] and not (xx==0 and yy ==0) then\n c = c + self:at({nx,ny})\n end\n end\n end\n \n local offset = self:to_offset({x,y})\n local current_state = self:at({x,y})\n \n new_grid[offset] = 0\n if current_state == 0 then\n if c == 3 then\n new_grid[offset] = 1\n end\n else\n if c==2 or c==3 then\n new_grid[offset] = 1\n else\n new_grid[offset] = 0\n end\n end\n-- \n end\n end\n self.grid = new_grid\nend", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ], + "id":"7958dd53-006c-480d-a4ad-9f04b147fd29" + }, + { + "cell_type":"code", + "source":"-- helper function to draw the grid as string\nfunction GameOfLife:__tostring()\n s = \"*\"\n for y=1, self.grid_size[2] do\n s = s .. \"--\"\n end\n s = s .. \"*\\n\"\n for x=1,self.grid_size[1] do\n s = s .. \"|\"\n for y=1, self.grid_size[2] do\n local state = self:at({x,y})\n if state == 0 then\n ss = \" \"\n else\n ss = \"O\"\n end\n s = s .. ss .. \" \"\n end\n s = s .. \"|\\n\"\n end\n s = s .. \"*\"\n for y=1, self.grid_size[2] do\n s = s .. \"--\"\n end\n s = s .. \"*\\n\"\n return s\nend", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ], + "id":"884414f6-8bc9-4719-9671-ef3be310356b" + }, + { + "cell_type":"code", + "source":"-- initalize the game of life\ngrid_size = {20,20}\ngame_of_life = GameOfLife:Create(grid_size)\ngame_of_life:init_random(0.5)\n\n-- a tiny gui\nfunction speed_to_interval(speed)\n return 1.0 / speed\nend\n\nspeed = 0.001\n\nhbox = ilua.widgets.hbox()\n\nplay = ilua.widgets.play({interval=speed_to_interval(speed), max=1000000})\noutput = ilua.widgets.output()\nstep_label = ilua.widgets.label({value=\"Step: \"..tostring(play.value)})\nspeed_label = ilua.widgets.label({value=\"Speed: \"..tostring(speed)})\nspeed_slider = ilua.widgets.slider({min=0.001, max=0.5, step=0.01})\n\nhbox:add(play,step_label,speed_label)\n\nspeed_slider:register_observer(function(value)\n output:captured(function()\n speed = value\n play.interval = speed_to_interval(speed)\n speed_label.value = \"Speed: \" .. tostring(speed)\n end)\nend)\n\nplay:register_observer(function(value)\n if value <= 0.1 then\n game_of_life:init_random(0.24)\n end\n -- use output widget to caputre prints \n output:captured(function()\n ilua.display.clear_output(false)\n step_label.value = \"STEP \"..tostring(play.value)\n game_of_life:step()\n print(tostring(game_of_life))\n end)\nend)\nilua.display.display(hbox,speed_slider, output)", + "metadata":{ + "trusted":true + }, + "execution_count":null, + "outputs":[ + + ], + "id":"40cabf23-7eef-4501-badd-99c1a68c5ced" + } + ] +} \ No newline at end of file diff --git a/content/xeus-lua/widgets.ipynb b/content/xeus-lua/widgets.ipynb new file mode 100644 index 0000000..ef337f0 --- /dev/null +++ b/content/xeus-lua/widgets.ipynb @@ -0,0 +1,632 @@ +{ + "cells": [ + { + "cell_type": "markdown", + "id": "6d755081-7f9f-4c6a-93e5-a28c8627a0ec", + "metadata": {}, + "source": [ + "Button\n", + "=======" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "be69e205-0c56-44b7-926b-5482d5300a38", + "metadata": {}, + "outputs": [], + "source": [ + "button = ilua.widgets.button({description=\"hello\"})\n", + "output = ilua.widgets.output()\n", + "ilua.display.display(button,output)\n", + "button:on_click(function()\n", + " output:captured(function()\n", + " print(\"clicked\")\n", + " end)\n", + "end)" + ] + }, + { + "cell_type": "markdown", + "id": "d11b0def-5115-4369-9972-4766802c846f", + "metadata": { + "tags": [] + }, + "source": [ + "Box Layout\n", + "==========" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "5d044224-ac2e-4722-b3fb-6d75b13ec366", + "metadata": { + "tags": [] + }, + "outputs": [], + "source": [ + "slider_a = ilua.widgets.slider({min=1, max=2, step=0.1})\n", + "slider_b = ilua.widgets.slider({min=10, max=20, step=1})\n", + "hbox = ilua.widgets.hbox()\n", + "output = ilua.widgets.output()\n", + "hbox:add(slider_a, slider_b)\n", + "ilua.display.display(hbox,output)\n", + "\n", + "slider_a:register_observer(function(value)\n", + " output:captured(function()\n", + " io.write(\"f(x) = x**2; f(\", value ,\")=\", value*value,\"\\n\")\n", + " end)\n", + "end)\n", + "slider_b:register_observer(function(value)\n", + " output:captured(function()\n", + " io.write(\"f(x) = x**3; f(\", value ,\")=\", value*value*value,\"\\n\")\n", + " end)\n", + "end)" + ] + }, + { + "cell_type": "markdown", + "id": "98e79948-9aeb-4c31-a7b9-3c6bce6c026f", + "metadata": {}, + "source": [ + "Accordion\n", + "================" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "b755c37d-602a-4b46-97ee-8e044f2f2314", + "metadata": {}, + "outputs": [], + "source": [ + "output = ilua.widgets.output()\n", + "button = ilua.widgets.button({description=\"a button\"})\n", + "button:on_click(function() \n", + " output:captured(function()\n", + " print(\"clicked button\")\n", + " end)\n", + "end)\n", + "slider = ilua.widgets.slider()\n", + "color_picker = ilua.widgets.color_picker()\n", + "audio = ilua.widgets.audio()\n", + "accordion = ilua.widgets.accordion()\n", + "accordion:add(slider,button,color_picker,audio)\n", + "accordion:set_title(1,\"the slider\")\n", + "accordion:set_title(2,\"the button\")\n", + "accordion:set_title(3,\"the color_picker\")\n", + "accordion:set_title(4,\"the audio\")\n", + "ilua.display.display(accordion, output)\n", + "\n", + "slider:register_observer(function(value)\n", + " output:captured(function()\n", + " print(\"slider value\", value)\n", + " end)\n", + "end)\n", + "\n", + "color_picker:register_observer(function(value)\n", + " output:captured(function()\n", + " print(\"color_picker value\", value)\n", + " end)\n", + "end)" + ] + }, + { + "cell_type": "markdown", + "id": "097d19f7-a0c9-48a9-8eff-6e3e06780c88", + "metadata": { + "tags": [] + }, + "source": [ + "Dropdown\n", + "=========" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "95e12c50-4e77-457c-b2c2-6d20421a3bea", + "metadata": {}, + "outputs": [], + "source": [ + "labels = {\"aaa\", \"bb\",\"cc\"}\n", + "dropdown = ilua.widgets.dropdown({_options_labels= labels})\n", + "output = ilua.widgets.output()\n", + "dropdown:register_observer(function(index)\n", + " output:captured(function()\n", + " print(labels[index])\n", + " end)\n", + "end)\n", + "\n", + "ilua.display.display(dropdown, output)" + ] + }, + { + "cell_type": "markdown", + "id": "ca362331-bd0c-4203-9a6f-dc937d309297", + "metadata": {}, + "source": [ + "Html\n", + "=======" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "abc66753-53ba-4361-96a6-48cd9460c8e3", + "metadata": { + "tags": [] + }, + "outputs": [], + "source": [ + "src = [[\n", + "\n", + "\n", + " \n", + " \n", + " \n", + "

My First Page

\n", + "

This is my first page.

\n", + "

A secondary header.

\n", + "

Some more text.

\n", + " \n", + "\n", + "]]\n", + "html = ilua.widgets.html({value=src})\n", + "ilua.display.display(html)" + ] + }, + { + "cell_type": "markdown", + "id": "e8eeacfe-350a-4ecb-81a9-c8091af3c22e", + "metadata": { + "tags": [] + }, + "source": [ + "numeral\n", + "========" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "9c177cfe-2613-43a3-a217-d93bc257420e", + "metadata": {}, + "outputs": [], + "source": [ + "numeral = ilua.widgets.numeral()\n", + "output = ilua.widgets.output()\n", + "numeral:register_observer(function(value)\n", + " output:captured(function()\n", + " print(\"value\", value)\n", + " end)\n", + "end)\n", + "ilua.display.display(numeral, output)" + ] + }, + { + "cell_type": "markdown", + "id": "9fede355-2e4f-48c9-b39b-1886e060ce8b", + "metadata": {}, + "source": [ + "password\n", + "========" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "455996cf-9b63-4d50-869a-0f479ab3daf4", + "metadata": {}, + "outputs": [], + "source": [ + "password = ilua.widgets.password()\n", + "output = ilua.widgets.output()\n", + "password:register_observer(function(value)\n", + " output:captured(function()\n", + " print(\"value\", value)\n", + " end)\n", + "end)\n", + "\n", + "ilua.display.display(password, output)" + ] + }, + { + "cell_type": "markdown", + "id": "6306ce8e-37d3-4dbc-a8cf-955b2dfe684c", + "metadata": {}, + "source": [ + "play\n", + "=====" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "986147ab-c9de-4ad9-b8be-f65260dd815d", + "metadata": {}, + "outputs": [], + "source": [ + "play = ilua.widgets.play({interval=1000})\n", + "output = ilua.widgets.output()\n", + "play:register_observer(function(value)\n", + " output:captured(function()\n", + " print(\"value\", value)\n", + " end)\n", + "end)\n", + "\n", + "ilua.display.display(play, output)" + ] + }, + { + "cell_type": "markdown", + "id": "4e03ccf2-3a10-40d6-8273-168a91f3d9a7", + "metadata": {}, + "source": [ + "progress\n", + "=========" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "a4f194ee-0995-44f3-8636-b629bd5b65ba", + "metadata": {}, + "outputs": [], + "source": [ + "progress = ilua.widgets.progress({min=10, max=20})\n", + "play = ilua.widgets.play({min=10, max=20, interval=100})\n", + "play:register_observer(function(value)\n", + " progress.value = value\n", + "end)\n", + "ilua.display.display(play, progress)" + ] + }, + { + "cell_type": "markdown", + "id": "39714034-99f4-4f36-b50f-33aa3f71d2a6", + "metadata": {}, + "source": [ + "Selection Slider\n", + "=================" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "7f6aab9e-b3ce-4df9-83a6-94eb725aceb0", + "metadata": {}, + "outputs": [], + "source": [ + "labels = {\"aaa\", \"bb\",\"cc\"}\n", + "selectionslider = ilua.widgets.selectionslider({_options_labels = labels})\n", + "output = ilua.widgets.output()\n", + "selectionslider:register_observer(function(index)\n", + " output:captured(function()\n", + " print(labels[index])\n", + " end)\n", + "end)\n", + "\n", + "ilua.display.display(selectionslider, output)" + ] + }, + { + "cell_type": "markdown", + "id": "45d72396-3fcc-421e-865e-487d93b333b8", + "metadata": {}, + "source": [ + "Tab\n", + "======" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "6d0684e8-62a2-4483-995a-70d7cc2783ac", + "metadata": {}, + "outputs": [], + "source": [ + "\n", + "\n", + "slider_a = ilua.widgets.slider()\n", + "slider_b = ilua.widgets.slider()\n", + "\n", + "titles = {\"aaa\", \"bb\",\"cc\"}\n", + "tab = ilua.widgets.tab({_titles = titles})\n", + "tab:add(slider_a,slider_b)\n", + "output = ilua.widgets.output()\n", + "\n", + "tab:register_observer(function(index)\n", + " -- use output widget to caputre prints \n", + " output:captured(function()\n", + " print(titles[index])\n", + " end)\n", + "end)\n", + "\n", + "ilua.display.display(tab,output)" + ] + }, + { + "cell_type": "markdown", + "id": "7f9f85de-a5b8-4e60-9eff-33b25d819ec9", + "metadata": {}, + "source": [ + "Text\n", + "=====" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "893e92ad-eff2-4adb-ba82-71a9ed2cfe9e", + "metadata": {}, + "outputs": [], + "source": [ + "text = ilua.widgets.text()\n", + "output = ilua.widgets.output()\n", + "text:register_observer(function(value)\n", + " output:captured(function()\n", + " print(\"value\", value)\n", + " end)\n", + "end)\n", + "\n", + "text:on_submit(function()\n", + " output:captured(function()\n", + " print(\"on_submit\")\n", + " end)\n", + "end)\n", + "\n", + "ilua.display.display(text, output)" + ] + }, + { + "cell_type": "markdown", + "id": "94572d62-12ea-4026-a531-d0e7bc5b20b9", + "metadata": {}, + "source": [ + "TextArea\n", + "=========" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "1e76b56f-f087-49f8-a50e-eb794060c63c", + "metadata": {}, + "outputs": [], + "source": [ + "textarea = ilua.widgets.textarea({continuous_update=false})\n", + "output = ilua.widgets.output()\n", + "textarea:register_observer(function(value)\n", + " output:captured(function()\n", + " print(\"value\", value)\n", + " end)\n", + "end)\n", + "ilua.display.display(textarea, output)" + ] + }, + { + "cell_type": "markdown", + "id": "68011d67-ac8c-43ff-bae9-4caf95273f98", + "metadata": {}, + "source": [ + "Toggle Button\n", + "=========" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "cf780275-b2de-48d4-bb2e-3f38e8c45bcd", + "metadata": { + "tags": [] + }, + "outputs": [], + "source": [ + "togglebutton = ilua.widgets.togglebutton({\n", + " icon=\"plus\",\n", + " button_style=\"\"\n", + "})\n", + "output = ilua.widgets.output()\n", + "togglebutton:register_observer(function(value)\n", + " output:captured(function()\n", + " print(\"value\", value)\n", + " end)\n", + "end)\n", + "\n", + "ilua.display.display(togglebutton, output)" + ] + }, + { + "cell_type": "markdown", + "id": "1bc5c504-cf9c-432f-a91c-2497910d787b", + "metadata": {}, + "source": [ + "ToggleButtons\n", + "=========" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "f764f285-d71f-4c93-92b4-923484846b0c", + "metadata": {}, + "outputs": [], + "source": [ + "togglebuttons = ilua.widgets.togglebuttons()\n", + "togglebuttons._options_labels = {\"1\", \"2\",\"3\"}\n", + "output = ilua.widgets.output()\n", + "togglebuttons:register_observer(function(value)\n", + " output:captured(function()\n", + " print(\"value\", value)\n", + " end)\n", + "end)\n", + "\n", + "ilua.display.display(togglebuttons, output)" + ] + }, + { + "cell_type": "markdown", + "id": "55447db2-bab0-4282-9a89-f6b9f8fd9e30", + "metadata": {}, + "source": [ + "Image\n", + "========" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "d21c5e4b-1d27-44e9-9966-0da4ef55f651", + "metadata": {}, + "outputs": [], + "source": [ + "io = require(\"io\")\n", + "file = io.open(\"marie.png\", \"r\")\n", + "content = file:read(\"*all\")\n", + "io.close(file)\n", + "\n", + "image = ilua.widgets.image()\n", + "image.value = content\n", + "ilua.display.display(image)" + ] + }, + { + "cell_type": "markdown", + "id": "ee4e079c-0101-49a9-94f6-2d7e73ad3f59", + "metadata": { + "tags": [] + }, + "source": [ + "Video\n", + "========" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "654c050a-3cff-48d2-b7a1-d8f6acfe042a", + "metadata": {}, + "outputs": [], + "source": [ + "io = require(\"io\")\n", + "file = io.open(\"Big.Buck.Bunny.mp4\", \"r\")\n", + "content = file:read(\"*all\")\n", + "io.close(file)\n", + "\n", + "video = ilua.widgets.video({loop=false})\n", + "video.value = content\n", + "ilua.display.display(video)" + ] + }, + { + "cell_type": "markdown", + "id": "829cf76c-238d-456f-a5b9-51f3a526f45c", + "metadata": {}, + "source": [ + "Audio\n", + "======" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "43922e68-ee53-40bd-bf2c-8dcc810bdb6a", + "metadata": {}, + "outputs": [], + "source": [ + "io = require(\"io\")\n", + "file = io.open(\"hehe.flac\", \"r\")\n", + "content = file:read(\"*all\")\n", + "io.close(file)\n", + "\n", + "audio = ilua.widgets.audio({loop=false})\n", + "audio.value = content\n", + "ilua.display.display(audio)" + ] + }, + { + "cell_type": "markdown", + "id": "2aee848b-a3e6-4ce3-9d2d-8650871bb225", + "metadata": {}, + "source": [ + "Valid\n", + "======" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "ef2ae714-2077-4767-9c24-af821fbc2c9d", + "metadata": {}, + "outputs": [], + "source": [ + "valid = ilua.widgets.valid()\n", + "valid.value = false\n", + "ilua.display.display(valid)" + ] + }, + { + "cell_type": "markdown", + "id": "96b64ffe-ac69-4b0e-9299-0a54842a77c1", + "metadata": {}, + "source": [ + "Link Widgets\n", + "============" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "191675ca-c53e-4c83-a0cf-8dcd78b02fae", + "metadata": {}, + "outputs": [], + "source": [ + "slider = ilua.widgets.slider()\n", + "numeral = ilua.widgets.numeral()\n", + "\n", + "link = ilua.widgets.link(slider, \"value\", numeral, \"value\")\n", + "ilua.display.display(link, slider, numeral)" + ] + }, + { + "cell_type": "markdown", + "id": "3d54b0cc-7f2f-4ad7-92a8-9f61abe989f9", + "metadata": {}, + "source": [ + "Directional Link\n", + "===================" + ] + }, + { + "cell_type": "code", + "execution_count": null, + "id": "21499154-6da9-4a4a-a6ce-7637916d26c6", + "metadata": {}, + "outputs": [], + "source": [ + "slider = ilua.widgets.slider()\n", + "numeral = ilua.widgets.numeral()\n", + "\n", + "link = ilua.widgets.directional_link(slider, \"value\", numeral, \"value\")\n", + "ilua.display.display(link, slider, numeral)" + ] + } + ], + "metadata": { + "kernelspec": { + "display_name": "Lua 0.2 (XLua)", + "language": "lua", + "name": "xlua" + }, + "language_info": { + "file_extension": ".lua", + "mimetype": "text/x-luasrc", + "name": "lua", + "version": "14.0.0" + } + }, + "nbformat": 4, + "nbformat_minor": 5 +} diff --git a/content/xeus-sqlite/simple-operations.ipynb b/content/xeus-sqlite/simple-operations.ipynb new file mode 100644 index 0000000..5d4c4a6 --- /dev/null +++ b/content/xeus-sqlite/simple-operations.ipynb @@ -0,0 +1,392 @@ +{ + "metadata": { + "kernelspec": { + "name": "SQLite", + "display_name": "SQLite", + "language": "sql" + }, + "language_info": { + "file_extension": ".sqlite3-console", + "mimetype": "text/x-sqlite3-console", + "name": "sqlite3", + "version": "0.4.0" + } + }, + "nbformat_minor": 4, + "nbformat": 4, + "cells": [ + { + "cell_type": "markdown", + "source": "# JupyterLite `xeus-sqlite` Kernel Demo\n\nThe [`jupyterlite/xeus-sqlite-kernel`](https://github.com/jupyterlite/xeus-sqlite-kernel) wraps the original [`jupyter-xeus/xeus-sqlite`](https://github.com/jupyter-xeus/xeus-sqlite/) kernel for use in JupyterLite.\n\nOriginal kernel docs can be found [here](https://xeus-sqlite.readthedocs.io/en/latest/).\n\nThe kernel provides cell magic for command line database operations, and native execution of SQL code against a connected database.", + "metadata": {} + }, + { + "cell_type": "markdown", + "source": "## Creating a Database\n\nLine magic is used to create an in-memory database:", + "metadata": {} + }, + { + "cell_type": "code", + "source": "%CREATE example_db.db", + "metadata": { + "trusted": true + }, + "execution_count": 1, + "outputs": [] + }, + { + "cell_type": "markdown", + "source": "Currently, there is no ability to:\n\n- save the database to browser storage;\n- export the database;\n- load a database from browser storage;\n- load a database from a URL;\n- load a database from the desktop;\n- connect to a remote sqlite database file.", + "metadata": {} + }, + { + "cell_type": "markdown", + "source": "## Create and Populate Tables\n\nTables are created and populated using SQL:", + "metadata": {} + }, + { + "cell_type": "code", + "source": "CREATE TABLE players (Name STRING, Class STRING, Level INTEGER, Hitpoints INTEGER)", + "metadata": { + "trusted": true + }, + "execution_count": 2, + "outputs": [] + }, + { + "cell_type": "code", + "source": "INSERT INTO players (Name, Class, Level, Hitpoints) VALUES (\"Martin Splitskull\", \"Warrior\", 3, 40)", + "metadata": { + "trusted": true + }, + "execution_count": 3, + "outputs": [] + }, + { + "cell_type": "code", + "source": "SELECT COUNT(*) as rowcount FROM players", + "metadata": { + "trusted": true + }, + "execution_count": 4, + "outputs": [ + { + "execution_count": 4, + "output_type": "execute_result", + "data": { + "text/html": "\n\n\n\n\n\n\n
rowcount
1
", + "text/plain": "+----------+\n| rowcount |\n+----------+\n| 1 |\n+----------+" + }, + "metadata": {} + } + ] + }, + { + "cell_type": "markdown", + "source": "Only one command can be executed from within a single code cell:", + "metadata": {} + }, + { + "cell_type": "code", + "source": "INSERT INTO players (Name, Class, Level, Hitpoints) VALUES (\"Sir Wolf\", \"Cleric\", 2, 20);\n\n-- The following will not be inserted\nINSERT INTO players (Name, Class, Level, Hitpoints) VALUES (\"Sylvain, The Grey\", \"Wizard\", 1, 10);", + "metadata": { + "trusted": true + }, + "execution_count": 5, + "outputs": [] + }, + { + "cell_type": "code", + "source": "SELECT Name, Level, Hitpoints FROM players;", + "metadata": { + "trusted": true + }, + "execution_count": 6, + "outputs": [ + { + "execution_count": 6, + "output_type": "execute_result", + "data": { + "text/html": "\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n
NameLevelHitpoints
Martin Splitskull340
Sir Wolf220
", + "text/plain": "+-------------------+-------+-----------+\n| Name | Level | Hitpoints |\n+-------------------+-------+-----------+\n| Martin Splitskull | 3 | 40 |\n+-------------------+-------+-----------+\n| Sir Wolf | 2 | 20 |\n+-------------------+-------+-----------+" + }, + "metadata": {} + } + ] + }, + { + "cell_type": "code", + "source": "INSERT INTO players (Name, Class, Level, Hitpoints) VALUES (\"Sylvain, The Grey\", \"Wizard\", 1, 10);", + "metadata": { + "trusted": true + }, + "execution_count": 7, + "outputs": [] + }, + { + "cell_type": "code", + "source": "SELECT Name, Level, Hitpoints FROM players;", + "metadata": { + "trusted": true + }, + "execution_count": 8, + "outputs": [ + { + "execution_count": 8, + "output_type": "execute_result", + "data": { + "text/html": "\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n
NameLevelHitpoints
Martin Splitskull340
Sir Wolf220
Sylvain, The Grey110
", + "text/plain": "+-------------------+-------+-----------+\n| Name | Level | Hitpoints |\n+-------------------+-------+-----------+\n| Martin Splitskull | 3 | 40 |\n+-------------------+-------+-----------+\n| Sir Wolf | 2 | 20 |\n+-------------------+-------+-----------+\n| Sylvain, The Grey | 1 | 10 |\n+-------------------+-------+-----------+" + }, + "metadata": {} + } + ] + }, + { + "cell_type": "markdown", + "source": "## Quuerying Tables\n\nA full range of SQL query commands are supported, including aggregation operations:", + "metadata": {} + }, + { + "cell_type": "code", + "source": "SELECT SUM (Level) FROM players", + "metadata": { + "trusted": true + }, + "execution_count": null, + "outputs": [] + }, + { + "cell_type": "markdown", + "source": "Grouping also works:", + "metadata": {} + }, + { + "cell_type": "code", + "source": "SELECT Level, SUM(Hitpoints) AS `Total Hitpoints`\nFROM players\nGROUP BY Level\nORDER BY `Total Hitpoints` DESC;", + "metadata": { + "trusted": true + }, + "execution_count": 11, + "outputs": [ + { + "execution_count": 11, + "output_type": "execute_result", + "data": { + "text/html": "\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n
LevelTotal Hitpoints
340
220
110
", + "text/plain": "+-------+-----------------+\n| Level | Total Hitpoints |\n+-------+-----------------+\n| 3 | 40 |\n+-------+-----------------+\n| 2 | 20 |\n+-------+-----------------+\n| 1 | 10 |\n+-------+-----------------+" + }, + "metadata": {} + } + ] + }, + { + "cell_type": "markdown", + "source": "## Charting Using Vega\n\nThe `jupyter-xeus/xeus-sqlite` kernel also bundles Vega charting components.\n\nVega charts can be generated by piping the result of a SQL query into a Vega line magic command.", + "metadata": {} + }, + { + "cell_type": "code", + "source": "%XVEGA_PLOT\n X_FIELD Level\n Y_FIELD Hitpoints\n MARK circle\n WIDTH 100\n HEIGHT 200\n <>\n SELECT Level, Hitpoints FROM players", + "metadata": { + "trusted": true + }, + "execution_count": 12, + "outputs": [ + { + "execution_count": 12, + "output_type": "execute_result", + "data": { + "text/html": "\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n
LevelHitpoints
340
220
110
", + "text/plain": "+-------+-----------+\n| Level | Hitpoints |\n+-------+-----------+\n| 3 | 40 |\n+-------+-----------+\n| 2 | 20 |\n+-------+-----------+\n| 1 | 10 |\n+-------+-----------+" + }, + "metadata": {} + }, + { + "execution_count": 12, + "output_type": "execute_result", + "data": { + "application/vnd.vegalite.v3+json": { + "$schema": "https://vega.github.io/schema/vega-lite/v4.json", + "config": { + "axis": { + "grid": true + } + }, + "data": { + "values": [ + { + "Hitpoints": "name", + "Level": "name" + }, + { + "Hitpoints": "40", + "Level": "3" + }, + { + "Hitpoints": "20", + "Level": "2" + }, + { + "Hitpoints": "10", + "Level": "1" + } + ] + }, + "encoding": { + "x": { + "field": "Level", + "type": "quantitative" + }, + "y": { + "field": "Hitpoints", + "type": "quantitative" + } + }, + "height": 200, + "mark": { + "type": "circle" + }, + "width": 100 + }, + "image/png": "iVBORw0KGgoAAAANSUhEUgAAAJMAAAD3CAYAAAAZgGZZAAAAAXNSR0IArs4c6QAAFBRJREFUeF7tnQlsFlUXhk9Ly77+gAUryCIgUIWwVQJKEbAGBEWpLFJZQqrmVwFBi1qgSItIoCAgSqSyCT8KyJZIoICyBatYoSxhKwpYbEGBFixr6Z9zzVe6fT132pnp943vTYhgz9w5896n79yZuTPHJycnJ4fQoIAJCvgAJhNURBdKAcAEEExTADCZJiU6AkxgwDQFAJNpUqIjy2G6c+cOXb58merWrZur9t9//02VKlUiX19fjICDFLAcpnHjxtGhQ4do69at9Oeff9KQIUPIz8+Pzpw5Q2+//TYNHz7cQXI681D2HUmlX/+4rA6ucf1a1Ll1YJEHailMGzdupM8++4zYnRim6dOn09WrVyk2NpbS0tKofv36xC5VuXJlZ46CA46KQUrYfzrfkfTq0KRIoCyD6fTp0/Tqq69SVFQUxcTEKJhGjRpFPXv2pEGDBhHfK+XTXEpKCjVp0sQBsjvzEFZuO0ynUv9xJVd7KLAWDekZVOiALYHpxo0b1L17d4qPj6crV65QdHS0gunFF19UfwYMGKASCQgIoMTERGrUqBHt2bOH9u7dmy9BnmeFhIQ4c5S85Kg2/5xK5/7Mys2WzyK2wsTghIaGUseOHSkjI4NOnDhBERERFBgYSNWrV6cxY8ZQdnY21apVS8HmbiL+0UcfUWRkZJnKzg7rCc5ZVnnkPc1lZWWpKYmtpzneaWpqqoLgwIEDFBcXR6tXr6akpCSaP3++cin+N///ffv2uYUFMN2Tpqxg4gxcE3C+Km/Xquj5EsdZcprLS8ePP/6o5k0M0PXr16l379509OhR9feEhAQKDg4GTBreW5YwudKTcrAcpqJ0OnfuHNWrV4/8/f2LlRHO5BnO5NEwafwiqhDABJh0WRHjABNgEiHRDQBMgEmXFTEOMAEmERLdAMAEmHRZEeMAE2ASIdENAEyASZcVMQ4wASYREt0AwASYdFkR4wATYBIh0Q0ATIBJlxUxDjABJhES3QDABJh0WRHjABNgEiHRDQBMgEmXFTEOMAEmERLdAMAEmHRZEeMAE2ASIdENAEyASZcVMQ4wASYREt0AwASYdFkR4wATYBIh0Q0ATIBJlxUxDjABJhES3QDABJh0WRHjABNgEiHRDQBMgEmXFTEOMAEmERLdAMAEmHRZEeMAE2ASIdENAEyASZcVMQ4wASYREt0AwASYdFkR4wATYBIh0Q0ATIBJlxUxDjABJhES3QDABJh0WRHjABNgEiHRDQBMgEmXFTEOMAEmERLdAMAEmHIVuHXrlqo1V7CenG4lTMAEmJQCEyZMoB07dlCrVq1U5aYVK1aoeilGKmECJsCkqltyvTkuwsOta9eu9M4776gCPEYqYQImwJSrwOHDh2nx4sX05Zdf0rFjx1RNXiOVMAETYMpVIDk5mT799FN1ilu/fr2q12ukEiZ3FBYWpjtfR5wNChRXyNGSEmFcuHD//v307LPPqsObOHGiqhzOBZ5RCbNkIy7VeitZr8a2knKwBCaumPjwww/TL7/8ourKhYeHU7du3dTfUQnT2AC6oqWBLFmvxraScrAEJk7xgw8+oJkzZ1KNGjWoTZs2tHz5cqpYsSIqYRobv9xoaSBL2K2hzaQcLIOJs+RbAVxJnAs7522ohGloDFWwNJDGezS+hZSDpTAZTzf/Friaw9VcaRnK3R4wASbAZJoCgMk0KeFMgAkwmaYAYDJNSjgTYAJMpikAmEyTEs4EmACTaQoAJtOkhDMBJsBkmgKAyTQp4UyACTCZpgBgMk1KOBNgAkymKQCYTJMSzgSYAJNpCgAm06SEMwEmwGSaAoDJNCnhTIAJMJmmwL8AJv6yiZ+fnwWS5e8SzuRAmPhlytGjR9O3335LvXr1oiNHjhAP9GuvvWYpUIDJgTB17txZvbfFr3m/8cYb1K5dOzp58iRdunTJUocCTA6DiV+irFSpEm3cuJHmzJlD/GUT/o5Aw4YN6eDBg/Too49a5k6AyWEw8eG0aNGCWrZsSRs2bKCIiAj1AYopU6bQtWvXqEqVKoDJMgUcCNOyZcto2LBh6sjYjfjjXX379lWfyrGywZkcCBNfvWVmZqr5EX8SJykpSZ3erL6iA0wOgunmzZvq4xPt27en6Oho5Ubc+GqO3enMmTNq7mRVA0wOgmnGjBkUGRnplhX+dmXBL+maCRZgchBM3333HW3ZsoUWLFhAISEh6su5rhYcHEz9+/c3k51CfQEmB8HkOpRNmzapD3ZZeUorikrA5ECYdu/eTbNmzaJ9+/blG/OUlBSqWrWqZe4EmBwIU+vWrdU3vPnOd/ny5XOPcPv27ZgzWfarlL9j6attdqQh5SB+OS47O1vdApg8ebK6orOzwZkc6EwjRoxQ1QZWrVqV7/uUgYGB5OPjYxlfgMmBMAUEBNCFCxcKQZORkaFuYlrVAJMDYeIHvFzzpGDjeigVKlSwiiW1zKW4+1yW7ThPx9I8wY4ceB+ekIeUQ7FzJl5mUrt2bVWViedOBVvTpk3J19fXMj0Bk0OciWvFsetMmzZNLT3Bac6y3xmtjiVX0OqklEFSDm6diZ2InYHLVPD6JX50UrCNHz8+362CUuZaaHM4k0OcqeDI8sqBnTt3Kqi4zJfOMznehtc81axZM193qIRp/NdOcgXjPRrfQspBvM/Eu2SIeMVA3kk4n/p4Xbi7FhcXRwsXLiR+hsfLV9hleP6FSpj6g3jt+i3ac+gcXbySRdf/zqTuHVtSswf+o9+ByZGlhunu3bvUsWNHNWeKiopSjjRv3jz66aefVNkvBqRgc823XCsxY2JiKD09nfi+FCph6o/wsi3J9FtahtogKytLaf/f/h2odvVK+p2YGFlqmP766y+qU6cOzZ07V71MwG3btm3qLZUffvhBOU9RjcuEcQEeFqFHjx7KxXg7VMLUG90bt+7QjP/dexbqgqlfl+bU9qEAvU5Mjio1TDk5OarMFz+fmz17tvrtiI2Npa+//prS0tKIb2i6a7wik++eBwUFUXx8PL388suohKk5wDdv36WlO1IKRXcLCqAWgdbdKJbSK3UlzI8//pjGjBmTbz98yps6darbffNDYJ4fsaMNHDhQxXENOlTClIbr3s8dd5pzHdrZs2dp3bp1ajL9/PPPK6dy11xuxqe1Tp065Ybx61KohKkPk+Mm4HzofM+JJ9z8qhNf1vfr148ef/xxt49STp06Rc2aNcunGr/dwsWfe/furZaz8NryhIQEt3Mu3hj3me5JKM1X9BEteaSUg9atAb4a47d587YuXbrQrl27SvQ4BZUwjQ+oNJDGezS+hZSDCBO7El+VNW7cmNasWaPq7E6aNImWLFlCJ06cKORAxlN0vwWcyYHOxPMjXmXJRZu5bd68WZ2u+AEwX+lZ1QCTA2HiCTdPvocPH66Ojl3pgQceoKFDh6p/Dx482JJvDgAmB8LkbnGc61D5nlNYWJjpBgWYHAjTjh07qEGDBupOODd+0/fnn39Wb/ryMhV+Q8Xf3x8wma6Ag2DiS/zjx4/TyJEj1R9+JZwbL5obO3Ys/fbbb/Tggw9aJiGcyUEwFfd6eLVq1Yifv5UrVw4wWaaAg2By50x8iHyF16hRI0tlhDM5CCbXoZw/f14tcNNZEGcmXYDJITDdvn1bXf7zA91FixapFQIFG14PN/NXp/i+pLvPdmQi5eD2DjgvuQ0NDVUTb34mx+uaCjb+oIWVbgVncogz8WHwBLu4xo9ZrGyAyUEwSa9+441eK3+V8vctnWLsyETKodgHveHh4cTrubnxXe7mzZtT27Ztc/Pmxyr8WWerGpzJQc6UFxJ2Kf5cM68YsKsBJsBkGmuAyUEw8dUav+rE7bnnnlMvA/C6blfr06ePpZ9vBkwOggkTcM/4+ggjJU1+TTsdFNORlEOxE3CeYBf19RPX/vjVJStWC7j6hzM5yJnsoL24fQAmwGQag4AJMAEm0xQATKZJCWcCTIDJNAUAk2lSwpkAE2AyTQHAZJqUcCbABJhMUwAwmSYlnAkwASbTFABMpkkJZwJMgMk0BQCTaVLCmQATYDJNAcBkmpRwJsAEmExTADCZJiWcCTABJtMUAEymSQlnAkyAyTQFAJNpUsKZAFM+mFw15/K+g4dKmMZ/36R31oz3aHwLKQexQoHxXf6zBRc7TE5OVkV7+HOG9913nyp26C2VME/+fomSUy7Q+bSL1Kzx/dT1kQZUtVL5kspR6u2kgSz1DjQ6kHKwDKa1a9fS3r17VY06roLJME2fPt0rKmH+lXmdPlm3X8nrKhrYqF4Nejn0UQ3JrQmRBtKavebvVcrBMphcafDpzQXTqFGjvKIS5oFT6bRx74l8MPE/3hncmSqW97Nj3ArtQxpIO5KScrAVJv7wBf8ZMGCAOnaufJCYmKi+2rtnzx7lZAWbFZUPJOGPp2bSzsPphcKGPdmUKvj7Sps7+uelroRZGnXyOpO3VMLEaa7oEfcoZ/KmSpiYgBcGyiNg4iu7unXrquqXqIRZMp+XBrJkvRrbSsrB8jlTUemiEqaxQeRoaSCN92h8CymHMoFJ9zBwB/yeUtJA6mpamjgpB8AkqCsJWJrBMbKtJ+Qh5QCYAJM204BJW6qSXQ6XsnvtzaWB1O6oFIFSDnAmOJM2XoBJWyo4kyQVYJIUgjNpKwSYtKWCM0lSASZJITiTtkKASVsqOJMkFWCSFIIzaSsEmLSlgjNJUgEmSSE4k7ZCgElbKjiTJBVgkhSCM2krBJi0pYIzSVIBJkkhOJO2QoBJWyo4kyQVYJIUgjNpKwSYtKWCM0lSASZJITiTtkKASVsqOJMkFWCSFIIzaSsEmLSlgjNJUgEmSSE4k7ZCgElbKjiTJBVgkhSCM2krBJi0pYIzSVIBJkkhOJO2QoBJWyo4kyQVYJIUgjNpKwSYtKWCM0lSASZJITiTtkKASVsqOJMkFWCSFIIzaSsEmLSlgjNJUgEmSSE4k7ZCgElbKjiTJBVgkhSCM2krBJi0pYIzSVIBJkkhOJO2Qh4JEyphao9fbqA0kMZ7NL6FlIOtX9v1pkqYLqklAY0PScm28IQ8pBxshclbKmHmHW5JwJKhYXwrT8hDysFWmLylEiZgKtnFiK0wGa2E6e/vT7dv3zb+a4wtLFGAy7yNHDnSbd+2wuQtlTDzquUJlaU4H0/IQ8rBVpi8qRKmCyhJQEssoIhOPSEPKQdbYfLGSpiSgIDpngK2wuTarTdVwgRM92CRtCgTmHR/m7k8fdeuXXXDLYnzhBz4wDwhDykHj4bJEjrQqWUKACbLpP33dewVMN29e1eVsa9SpYrtI3Tnzh26desWVa5c2fZ9u3bIOVy7do1q1qxpew6XL1+mWrVqae3X42FavHgxzZkzhwIDA4lFXbFiBfHNM6tbdnY2HT58mOLj46lcuXI0e/Zsq3dZZP9xcXG0cOFCCg4OpszMTHW/qUWLFpbncuzYMXrppZeoadOmlJWVRUOHDqVBgwYVu1+Phonh4bvgV65coRo1atCbb75J9evXp3fffddyMdkJJk2aRPv376f27duXCUzsiBUqVFCuxK4cExND6enpNG/ePMuPnyFmrQcPHkzbtm2jcePG0cGDB70Xpl9//ZV69uxJKSkp6iBYxAMHDii3sKt98skndOrUqTKBiY/RdZphd+jRoweNHj1adAgztVmwYIFyxvDwcBo/frz3wpScnExhYWF0/PhxdRDLly+nnTt30qJFi8zUq9i+yhomTi4pKYlGjBhBQUFB6hepYsWKth0/n97Xrl2r5oxbt271Xph40s0HwRNwHx+fXHcYO3asbWKWNUzbt2+nIUOG0Ny5c2ngwIG2Hff69eupU6dOdP/996tpBk/CU1NT1b/dNY+eM3HSbdq0IbbaRx55hEJDQ2nKlCn01FNP2SZqWcKUk5Oj5oo8Z+GBtbNNmDBBzdcmT55MR48eVafY8+fPq4sRr4WJHw7zlQS3Pn360MqVK5VL2dUYJp6z8YTU7sZztWbNmuXb7bBhw2jJkiWWp8IARURE0MmTJ6l8+fI0bdo0NW8qrnm8M3HyPPnMyMhQVxdo9irwxx9/UEBAAPn6+oo79gqYxKNAgEcoAJg8YhickQRgcsY4esRRACaPGAZnJAGYnDGOHnEUgMkjhsEZSQAmg+PYr18/2rRpU+7DV4Oba4XzDcqbN2+KD1a1OrMxCDAZFNsF09WrV6lq1aoGt9YL51UKN27coCNHjuht4CFRgMngQBQH065du4jvmH///fcUEhKi/v7VV1/R0qVLaf78+eqRyIwZM2jNmjXqDy8x4UdFvEaL1yjxuq127dqpJS+AyeDAeGO4O5h4zVG1atWoS5cu9PTTT9PEiRPVs8SpU6cqiN577z2KjY1Vi83Y0XhtUPfu3dVzL35w/fnnn9PFixeJ7zg/8cQTgMkb4TCaszuYVq9eTa7X39lleIXo77//rlZHdujQgfz8/JQbtWrVSq0AeOGFF9Tq0ccee4x69eql3Gz37t20efNmev/99wGT0YHxxnh3MH344YfKfXi5SJMmTXIPLTIyUp3K+L+vv/66Ot2x+/DDY36Ni52MHcrVeJkJP8zFac4b6TCYswumqKgo9TSdG7sOz3P4tMYwvfLKKzRz5kz1/7/55hvil04bNmyoYvv27Uu8EuLSpUtUu3Ztat68OX3xxRe0atUqSkxMpA0bNtAzzzwDmAyOi1eGu2AqmDyvPeLF/rxU5cKFC2r+xAvMnnzySRXKa7ASEhLUqY5Pcdz4FkN0dLRaSclt1qxZ9NZbb6k5Fm4NeCUe5ibNb7WcPXuWGjRooJxJp3F8nTp1yvR1Kp08pRjcGpAUws+1FQBM2lIhUFIAMEkK4efaCgAmbakQKCkAmCSF8HNtBf4PeeHBOWN20+UAAAAASUVORK5CYII=" + }, + "metadata": {} + } + ] + }, + { + "cell_type": "markdown", + "source": "## Database Admininstration\n\nSeveral line magics are defined to support database administration", + "metadata": {} + }, + { + "cell_type": "code", + "source": "%TABLE_EXISTS players", + "metadata": { + "trusted": true + }, + "execution_count": 15, + "outputs": [ + { + "execution_count": 15, + "output_type": "execute_result", + "data": { + "text/plain": "The table players exists." + }, + "metadata": {} + } + ] + }, + { + "cell_type": "code", + "source": "%TABLE_EXISTS npcs", + "metadata": { + "trusted": true + }, + "execution_count": 16, + "outputs": [ + { + "execution_count": 16, + "output_type": "execute_result", + "data": { + "text/plain": "The table npcs doesn't exist." + }, + "metadata": {} + } + ] + }, + { + "cell_type": "code", + "source": "%GET_INFO", + "metadata": { + "trusted": true + }, + "execution_count": 17, + "outputs": [ + { + "execution_count": 17, + "output_type": "execute_result", + "data": { + "text/plain": "Magic header string: SQLite format 3\nPage size bytes: 4096\nFile format write version: 1\nFile format read version: 1\nReserved space bytes: 0\nMax embedded payload fraction 64\nMin embedded payload fraction: 32\nLeaf payload fraction: 32\nFile change counter: 4\nDatabase size pages: 2\nFirst freelist trunk page: 0\nTotal freelist trunk pages: 0\nSchema cookie: 1\nSchema format number: 4\nDefault page cache size bytes: 0\nLargest B tree page number: 0\nDatabase text encoding: 1\nUser version: 0\nIncremental vaccum mode: 0\nApplication ID: 0\nVersion valid for: 4\nSQLite version: 3032003\n" + }, + "metadata": {} + } + ] + }, + { + "cell_type": "markdown", + "source": "## Connecting to a Different Databases\n\nCreating a new database will connect the kernel to the new database instance.", + "metadata": {} + }, + { + "cell_type": "code", + "source": "%CREATE potato.db ", + "metadata": { + "trusted": true + }, + "execution_count": 18, + "outputs": [] + }, + { + "cell_type": "code", + "source": "CREATE TABLE potaters(production INTEGER)", + "metadata": { + "trusted": true + }, + "execution_count": 19, + "outputs": [] + }, + { + "cell_type": "code", + "source": "INSERT INTO potaters (production) VALUES (7)", + "metadata": { + "trusted": true + }, + "execution_count": 20, + "outputs": [] + }, + { + "cell_type": "code", + "source": "SELECT * FROM potaters", + "metadata": { + "trusted": true + }, + "execution_count": 21, + "outputs": [ + { + "execution_count": 21, + "output_type": "execute_result", + "data": { + "text/html": "\n\n\n\n\n\n\n
production
7
", + "text/plain": "+------------+\n| production |\n+------------+\n| 7 |\n+------------+" + }, + "metadata": {} + } + ] + }, + { + "cell_type": "markdown", + "source": "The original database is lost:", + "metadata": {} + }, + { + "cell_type": "code", + "source": "SELECT Name, Level, Hitpoints FROM players;", + "metadata": { + "trusted": true + }, + "execution_count": 23, + "outputs": [ + { + "ename": "Error", + "evalue": "no such table: players", + "traceback": [ + "Error: no such table: players" + ], + "output_type": "error" + } + ] + } + ] +} \ No newline at end of file diff --git a/repl/jupyter-lite.json b/repl/jupyter-lite.json new file mode 100644 index 0000000..c202a1b --- /dev/null +++ b/repl/jupyter-lite.json @@ -0,0 +1,11 @@ +{ + "jupyter-lite-schema-version": 0, + "jupyter-config-data": { + "disabledExtensions": [ + "@jupyterlab/drawio-extension", + "jupyterlab-kernel-spy", + "jupyterlab-tour" + ] + } + } + \ No newline at end of file diff --git a/requirements.txt b/requirements.txt new file mode 100644 index 0000000..d1de9bc --- /dev/null +++ b/requirements.txt @@ -0,0 +1,49 @@ +# Core modules (mandatory) +jupyterlite-core==0.2.2 +jupyterlab~=4.0.9 +notebook~=7.0.6 + + +# Python kernel (optional) +jupyterlite-pyodide-kernel==0.2.0 + +# JavaScript kernel (optional) +jupyterlite-javascript-kernel==0.2.2 + +# Language support (optional) +jupyterlab-language-pack-fr-FR +jupyterlab-language-pack-zh-CN + +# SQLite kernel (optional) +jupyterlite-xeus-sqlite==0.2.1 +# P5 kernel (optional) +jupyterlite-p5-kernel==0.1.0 +# Lua kernel (optional) +jupyterlite-xeus-lua==0.3.1 + +# JupyterLab: Fasta file renderer (optional) +jupyterlab-fasta>=3.3.0,<4 +# JupyterLab: Geojson file renderer (optional) +jupyterlab-geojson>=3.4.0,<4 +# JupyterLab: guided tour (optional) +# TODO: re-enable after https://github.com/jupyterlab-contrib/jupyterlab-tour/issues/82 +# jupyterlab-tour +# JupyterLab: dark theme +jupyterlab-night +# JupyterLab: Miami nights theme (optional) +jupyterlab_miami_nights + +# Python: ipywidget library for Jupyter notebooks (optional) +ipywidgets>=8.1.1,<9 +# Python: ipyevents library for Jupyter notebooks (optional) +ipyevents>=2.0.1 +# Python: interative Matplotlib library for Jupyter notebooks (optional) +ipympl>=0.8.2 +# Python: ipycanvas library for Jupyter notebooks (optional) +ipycanvas>=0.9.1 +# Python: ipyleaflet library for Jupyter notebooks (optional) +ipyleaflet + +# Python: plotting libraries (optional) +plotly>=5,<6 +bqplot